Recombinant Human Cytochrome P450 4X1 (CYP4X1)

Shipped with Ice Packs
In Stock

Description

Expression and Purification of CYP4X1

CYP4X1 has been expressed in Escherichia coli using codon-optimized cDNA constructs to enhance its expression levels. The highest expression levels were achieved with a bicistronic construct that included the cDNA for human NADPH-P450 reductase, reaching up to 300-450 nmol P450/L culture . This recombinant protein has been shown to oxidize anandamide, an important endocannabinoid, to 14,15-EET ethanolamide, suggesting a potential role in neurovascular signaling pathways .

Biological Functions and Significance

CYP4X1 is primarily expressed in brain regions and skin, as indicated by quantitative PCR analysis . Its role in the brain suggests involvement in neurological functions, possibly through the metabolism of endocannabinoids like anandamide. Additionally, CYP4X1 has been implicated in the progression of colorectal cancer (CRC), where its overexpression is associated with metastasis, poor prognosis, and shorter survival times .

Role in Colorectal Cancer

Recent studies have demonstrated that CYP4X1 expression is significantly higher in CRC tissues compared to normal colon tissues. High CYP4X1 expression correlates with advanced TNM stages, poor tumor differentiation, deeper invasion, and lymph node metastasis . Downregulation of CYP4X1 in CRC cells inhibits cell proliferation, invasion, migration, and colony formation, suggesting its potential as a therapeutic target .

Table 1: CYP4X1 Expression in Colorectal Cancer

ParameterCYP4X1 ExpressionAssociation
TNM StageHigh in advanced stagesMetastasis and poor prognosis
Tumor DifferentiationHigh in poorly differentiated tumorsPoor prognosis
Lymph Node MetastasisHigh in metastatic casesShorter survival times
Cell ProliferationInhibits proliferation upon downregulationPotential therapeutic target

Table 2: CYP4X1 Expression Levels in Different Tissues

Tissue TypeCYP4X1 Expression Level
Brain RegionsHigh
SkinHigh
Normal Colon TissueLow or absent
Colorectal Cancer TissueSignificantly higher than normal tissue

References

  1. Kim, S., et al. (2023). Expression of CYP4X1 in colorectal carcinoma is associated with metastasis and poor prognosis. Research Square.

  2. Stark, K., et al. (2006). Expression and purification of orphan cytochrome P450 4X1 and oxidation of anandamide. PMC.

  3. [Anonymous] (2025). CYP4X1 Expression Is Associated with Metastasis and Poor Prognosis in Colorectal Cancer. PMC.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CYP4X1; UNQ1929/PRO4404; Cytochrome P450 4X1; CYPIVX1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-509
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CYP4X1
Target Protein Sequence
MEFSWLETRWARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKF IQDDNMEKLEEIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQKFSPPL LGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEV YEHINSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKL SPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIVLSAKDESGSS FSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSITWDQ LGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVW KNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPD PTRPLTFPNHFILKPKNGMYLHLKKLSEC
Uniprot No.

Target Background

Function

Recombinant Human Cytochrome P450 4X1 (CYP4X1) is a monooxygenase that selectively catalyzes the epoxidation of the final double bond in the arachidonoyl moiety of anandamide, potentially influencing endocannabinoid signaling. It lacks hydroxylase activity toward various fatty acids, steroids, and prostaglandins. Mechanistically, it utilizes molecular oxygen, incorporating one oxygen atom into the substrate and reducing the second to water. The required two electrons are provided by NADPH via cytochrome P450 reductase (CPR).

Gene References Into Functions
  1. Key residues crucial for arachidonic acid and anandamide binding to human CYP4X1 have been identified. PMID: 25595103
  2. PPARα plays a role in CYP4X1 regulation, while glucocorticoid and progesterone receptors are involved in CYP4Z1 gene activation. PMID: 15797250
Database Links

HGNC: 20244

OMIM: 614999

KEGG: hsa:260293

STRING: 9606.ENSP00000360968

UniGene: Hs.439760

Protein Families
Cytochrome P450 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in brain, heart, kidney and skin and, at lower levels, in skeletal muscle and liver. In the brain, high levels are detected in amygdala and lower levels in globus pallidus and cerebellum. In the heart, very high levels in aorta, but very low lev

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.