Recombinant Human cytomegalovirus G-protein coupled receptor homolog US27 (US27)

Shipped with Ice Packs
In Stock

Description

Introduction to Human Cytomegalovirus and US27

Human cytomegalovirus (HCMV) is a widespread pathogen and member of the Herpesviridae family, with infection rates ranging from 45% to 100% in adults globally, depending on geographical region . HCMV represents the most common congenital infection worldwide, potentially causing deafness, blindness, and other serious birth defects . To establish lifelong latent infection, HCMV has evolved sophisticated mechanisms to manipulate host cellular functions and immune responses .

Among HCMV's immunomodulatory genes are four G-protein coupled receptors (GPCRs) designated US27, US28, UL33, and UL78 . These viral GPCRs (vGPCRs) are thought to have been acquired through co-option of host chemokine receptors over millions of years of co-evolution, enabling the virus to evade host immunity . While US28 has been extensively characterized as a functional chemokine receptor with both constitutive and ligand-dependent signaling capabilities, US27 has emerged as an equally important but mechanistically distinct viral GPCR with unique properties and functions in HCMV pathogenesis .

Protein Structure and Domains

US27 is structurally similar to host chemokine receptors but possesses distinctive features that differentiate it from its human counterparts. Unlike many cellular GPCRs, US27 is classified as an "orphan receptor" because it lacks known chemokine ligands and a conventional ligand-binding pocket . This characteristic distinguishes US27 from US28, which interacts promiscuously with various chemokine ligands .

Two critical domains have been identified in US27 that contribute to its functionality:

  1. The DRY box motif - A highly conserved amino acid sequence (typically Asp-Arg-Tyr) found in the second intracellular loop of GPCRs that is critical for G protein coupling and signal transduction .

  2. The C-terminal intracellular domain (CTD) - This region plays an essential role in mediating US27's effects on cellular proliferation and potentially interacts with downstream signaling molecules .

Mutation studies have demonstrated that an alanine substitution in the DRY box domain (R128A, creating what is termed the "DAY" mutant) significantly impairs US27's ability to activate antioxidant response element (ARE)-driven gene expression, confirming the essential nature of this motif for signaling functionality .

Post-translational Modifications

US27 undergoes extensive post-translational modification, most notably heavy glycosylation, which has been observed in both infected human foreskin fibroblasts and enveloped virions . This glycosylation pattern likely contributes to the protein's stability, trafficking, and potentially its interactions with host cellular components.

Virion Incorporation

US27 is packaged into mature HCMV virions and delivered to cells immediately upon infection . Experimental evidence has shown that US27 derived from the parental virion (not newly synthesized protein) is sufficient to promote increased CXCR4 mRNA levels during the earliest stages of HCMV infection . This was demonstrated through experiments using cycloheximide to block protein synthesis prior to viral infection, where US27 was still detected alongside pp65 (a tegument protein) in infected cells .

Cellular Distribution

US27 undergoes rapid endocytosis at a rate that is independent of both CXCR4 expression and CXCL12 stimulation, suggesting constitutive internalization and recycling dynamics . This dynamic movement between the cell surface and intracellular compartments may be crucial for US27's ability to modulate host cell signaling pathways and receptor trafficking.

Activation of the NRF-1/ARE Pathway

One of the most significant discoveries regarding US27 function is its ability to activate the nuclear respiratory factor 1 (NRF-1)/antioxidant response element (ARE) pathway . This activation results in increased transcription of various stress response genes, including CXCR4.

The signaling cascade appears to involve:

  1. US27 activation of G protein βγ subunits

  2. Subsequent activation of phosphoinositide 3-kinase (PI3K)

  3. Increased translocation of NRF-1 into the nucleus

  4. Enhanced transcriptional activity at the ARE in target gene promoters

This effect has been confirmed through reporter gene assays demonstrating that US27 specifically increases ARE-driven gene expression, an effect that is abolished in the DRY box mutant (R128A) .

Modulation of CXCR4 Expression and Signaling

US27 significantly enhances the expression and signaling capacity of the host chemokine receptor CXCR4 . This effect manifests through multiple mechanisms:

  1. Increased CXCR4 transcription via the NRF-1/ARE pathway

  2. Altered CXCR4 receptor internalization dynamics

  3. Enhanced CXCR4-mediated calcium signaling and cell migration in response to CXCL12

Table 1: Effects of US27 on CXCR4 and Associated Pathways

EffectMechanismBiological SignificanceReferences
Increased CXCR4 expressionActivation of NRF-1/ARE pathwayEnhanced chemokine responsiveness
Altered CXCR4 internalizationModification of receptor traffickingProlonged or enhanced signaling
Enhanced cell migrationAugmented CXCL12/CXCR4 signalingPotential increased viral dissemination
Calcium signaling amplificationUnknown, requires proximity to CXCR4Modified cellular responses

Notably, the enhancement of CXCR4 signaling by US27 requires close proximity to CXCR4 in cell membranes, suggesting a potential direct interaction or co-localization in specific membrane microdomains .

Impact on Cell Proliferation and Survival

US27 expression has been linked to increased cellular proliferation and enhanced cell survival . These effects appear to be mediated, at least in part, through the down-regulation of negative cell cycle regulators:

  1. CDKN1A/p21/CIP1 (cyclin-dependent kinase inhibitor 1A)

  2. SESN (Sestrin2 or Hi95)

Both the DRY box and C-terminal domains of US27 are required for the full proliferative effect, while cell survival seems to be influenced by additional protein regions beyond these two domains . This suggests that US27 likely interacts with multiple cellular pathways to promote both proliferation and survival.

Interaction with G Proteins

Cryo-electron microscopy structures have revealed that US27 forms a nonproductive complex with Gi proteins . Unlike typical GPCR-G protein interactions, US27 captures guanosine diphosphate (GDP)-bound inactive Gi through a tenuous interaction . This unusual binding mode suggests that US27 may function as a "Gi sink," sequestering these signaling proteins to attenuate host chemokine-dependent Gi signaling pathways .

The docking modes of US27 to Gi appear to favor localization to endosome-like curved membranes, which may influence the subcellular distribution and function of this viral GPCR .

Role of US27 in HCMV Pathogenesis

The multifaceted activities of US27 likely contribute to HCMV pathogenesis in several ways:

Immune Evasion

By modulating the expression and signaling of CXCR4, which plays crucial roles in both fetal development and immune responses, US27 may help HCMV evade host immunity . The activation of stress response genes through the NRF-1/ARE pathway could also create a cellular environment more favorable for viral replication .

Viral Dissemination

The enhancement of CXCL12/CXCR4-mediated cell migration could promote the trafficking of HCMV-infected cells to tissues where CXCL12 is highly expressed, potentially facilitating viral dissemination throughout the host . This mechanism represents a sophisticated viral strategy to exploit host chemokine gradients for enhanced spread.

Cellular Survival and Proliferation

By promoting cell proliferation and survival through the modulation of cell cycle regulators, US27 likely creates a cellular environment that supports extended viral production and persistence . This could be particularly important for maintaining infection in specific cell populations that serve as viral reservoirs.

Recombinant US27 in Research Applications

Recombinant forms of US27 have been essential for studying this viral GPCR's properties and functions. Several experimental approaches have been employed:

Viral Recombinants

Researchers have constructed recombinant viruses with modifications to the US27 gene to study its function within the context of viral infection. Examples include:

  • TB40/E-mCherry-US27Δ - A mutant with the entire US27 ORF deleted

  • TB40/E-mCherry-US27wt - A recombinant that expresses only US27 among the four viral GPCRs

These viral constructs have been instrumental in demonstrating that US27 is responsible for the increased CXCR4 expression observed during HCMV infection .

Cell Line Models

Cell lines stably expressing US27 have been developed to study its functions in isolation:

  • 293-US27 - HEK293 cells expressing wild-type US27

  • 293-27/DAY - HEK293 cells expressing the DRY box mutant (R128A)

These cell models have revealed that US27 expression leads to enhanced cell proliferation and activation of the ARE-driven gene expression .

Tagged Recombinant Systems

Novel biosensor systems have been employed to track US27 dynamics in live cells:

  • Fluorogen-activating proteins (FAPs) tagged to US27 have been used to monitor receptor internalization and recovery dynamics in real-time

This approach demonstrated that US27 undergoes rapid endocytosis and provided insights into how US27 affects CXCR4 internalization kinetics .

Comparison with Other HCMV GPCRs

HCMV encodes four GPCRs (US27, US28, UL33, and UL78) that exhibit distinct properties and functions despite their presumed common evolutionary origin .

Table 2: Comparison of HCMV-encoded GPCRs

FeatureUS27US28UL33UL78
Ligand bindingOrphan receptor (no known ligands)Promiscuous (binds CX3C and CC chemokines)No confirmed ligandsNo confirmed ligands
SignalingEnhances CXCR4 signaling; activates NRF-1/ARE pathwayConstitutive and ligand-dependent signalingSome constitutive activityLimited information
G protein interactionForms nonproductive complex with GiForms productive complex with GqCan couple to multiple G proteinsLimited information
Virion incorporationPresent in virionsPresent in virionsPresent in virionsLimited information
Effect on host cellsPromotes proliferation and survival; enhances CXCR4 signalingVarious effects including migration, apoptosis, cell signalingLimited informationLimited information

US27 and US28 represent the best-characterized viral GPCRs encoded by HCMV, with US28 functioning as a constitutively active chemokine receptor that can signal through multiple pathways . In contrast, US27 appears to have evolved specialized functions related to modulating host CXCR4 expression and signaling, despite lacking conventional ligand-binding capabilities .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will fulfill your requirement.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: Our standard shipping includes blue ice packs. For dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is recommended to briefly centrifuge the vial to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard protocol includes 50% glycerol; this can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms maintain a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. Should you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
US27; G-protein coupled receptor homolog US27; HHRF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Target Names
US27
Target Protein Sequence
MTTSTNNQTLTQVSNMTNHTLNSTEIYQLFEYTRLGVWLMCIVGTFLNVLVITTILYYRR KKKSPSDTYICNLAVADLLIVVGLPFFLEYAKHHPKLSREVVCSGLNACFYICLFAGVCF LINLSMDRYCVIVWGVELNRVRNNKRATCWVVIFWILAVLMGMPHYLMYSHTNNECVGEF ANETSGWFPVFLNTKVNICGYLAPIALMAYTYNRMVRFIINYVGKWHMQTLHVLLVVVVS FASFWFPFNLALFLESIRLLAGVYNDTLQNVIIFCLYVGQFLAYVRACLNPGIYILVGTQ MRKDMWTTLRVFACCCVKQEIPYQDIDIELQKDIQRRAKHTKRTHYDRKNAPMESGEEEF LL
Uniprot No.

Target Background

Function
Plays an important role in the spread of HCMV via the extracellular route. As a G-protein-coupled receptor (vGPCR), it may activate signaling pathways essential for virion assembly or egress processes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Virion. Host cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of the Human Cytomegalovirus US27 GPCR homolog?

US27 is a G protein-coupled receptor homolog encoded by Human cytomegalovirus (HCMV) that exhibits characteristic structural features of chemokine receptors. The protein contains seven α-helical transmembrane domains, conserved cysteine residues in the extracellular loops, and extensive glycosylation on extracellular asparagine residues. US27 possesses a DRY (aspartic acid, arginine, tyrosine) motif in the second intracellular loop, which is typically conserved in GPCRs and facilitates interactions with intracellular G proteins upon receptor activation. Additionally, the carboxy-terminal domain contains a dileucine motif that mediates receptor endocytosis. Despite these structural similarities to chemokine receptors, US27 is currently considered an orphan receptor, as no human chemokines have been identified that bind or signal through this receptor .

How does US27 differ from other HCMV-encoded GPCR homologs?

HCMV encodes four GPCR homologs: US27, US28, UL33, and UL78. While all four receptors modulate host CXCR4 signaling, they do so in distinct ways. US28, UL33, and UL78 impair CXCR4 signaling outcomes, whereas US27 uniquely enhances signaling, as evidenced by increased calcium mobilization and cell migration in response to CXCL12. Evolutionarily, UL33 and UL78 homologs are found in both primate and rodent cytomegaloviruses, while US27 and US28 are restricted to viruses infecting primates. This suggests that US27 and US28 likely evolved by gene duplication followed by functional divergence. Unlike US28, which constitutively activates inositol phosphate turnover and NF-κB or CREB pathways, US27 does not demonstrate these signaling capabilities in isolation, suggesting distinct functional roles within viral pathogenesis .

What experimental systems are typically used to study US27 function?

Research on US27 function typically employs several complementary experimental systems. For cellular studies, researchers use transfection of US27 expression constructs in various cell lines, including human embryonic kidney (HEK) 293T cells and human foreskin fibroblasts (HFF). Viral studies often utilize bacterial artificial chromosome (BAC)-derived clinical strain HCMV TB40/E or laboratory-adapted strains, with wild-type virus compared to US27-deletion mutants (US27Δ). To assess US27's impact on CXCR4 expression and signaling, quantitative PCR for mRNA levels, Western blotting for protein expression, immunofluorescence for localization, and calcium mobilization assays for functional signaling are commonly employed. Additionally, cell migration assays using transwell chambers help evaluate US27's influence on CXCR4-mediated chemotaxis in response to CXCL12. Researchers also use cycloheximide treatment to block protein synthesis, allowing differentiation between effects of virion-incorporated US27 versus those from de novo protein synthesis .

How does US27 modulate CXCR4 expression and signaling at the molecular level?

US27 stimulates increased expression of CXCR4 through a specific molecular pathway involving the transcription factor nuclear respiratory factor 1 (NRF-1). Mechanistically, US27 activates the NRF-1/antioxidant response element (ARE) pathway, which regulates stress response genes. This activation leads to enhanced transcription of CXCR4, resulting in increased mRNA and protein levels. The molecular evidence demonstrates that US27 from the virus particle is sufficient to promote this increase in CXCR4 mRNA levels during early HCMV infection, even when de novo protein synthesis is blocked with cycloheximide. This indicates that virion-incorporated US27 can initiate signaling cascades immediately upon infection. The enhanced CXCR4 expression leads to amplified signaling outcomes, including increased calcium mobilization and cell migration in response to the CXCR4 ligand CXCL12. This modulation represents a sophisticated viral strategy that hijacks host chemokine signaling networks to potentially benefit viral dissemination and persistence .

What are the implications of US27-mediated cell-to-cell spread versus extracellular viral dissemination?

Studies with pUS27-deficient HCMV strains have revealed critical insights into US27's role in viral dissemination strategies. In experimental systems using clinical isolates like TB40/E, pUS27-deficient viruses exhibit a selective growth defect in endothelial cells, where wild-type virus normally generates extracellular virus. Interestingly, these mutants show little defect in epithelial cells, where the wild-type virus primarily relies on direct cell-to-cell spread. This differential effect suggests that US27 functions at a late stage of the HCMV replication cycle to specifically support virus spread through the extracellular route, while being less critical for direct cell-to-cell transmission. The mechanistic basis for this may involve US27's enhancement of CXCR4 expression and signaling, which could promote the release or trafficking of infectious virions. This selective advantage for extracellular spread may be particularly important for establishing disseminated infection in specific tissues or for crossing tissue barriers during pathogenesis. Understanding these distinct dissemination mechanisms provides insights into HCMV's tissue tropism and potential targets for therapeutic intervention .

How might US27's activation of the NRF-1/ARE pathway contribute to viral immune evasion?

The US27-mediated activation of the NRF-1/ARE pathway has significant implications beyond CXCR4 regulation, particularly for viral immune evasion strategies. NRF-1 regulates numerous stress response genes containing the antioxidant response element (ARE), and HCMV infection is associated with increased expression of these genes when US27 is present. This broad modulation of the cellular stress response may create an intracellular environment that favors viral replication while interfering with host antiviral mechanisms. Specifically, the upregulation of CXCR4 could redirect immune cell trafficking or alter thymic selection of T cells, potentially diminishing antiviral responses. Additionally, the activation of stress response genes might counteract cellular apoptosis that would otherwise limit viral spread. The NRF-1/ARE pathway also interfaces with mitochondrial function and metabolic regulation, potentially reprogramming cellular energy production to benefit viral replication. These multiple effects converge to potentially enhance HCMV's capacity to establish persistent infection by modulating both cell-autonomous and systemic immune responses, representing a sophisticated viral adaptation to the host environment .

What are the critical considerations for generating and validating US27 deletion mutants?

When generating US27 deletion mutants for functional studies, several methodological considerations are essential for robust and reproducible results. First, researchers should employ bacterial artificial chromosome (BAC) recombineering techniques with clinical isolates (like TB40/E) rather than laboratory-adapted strains to maintain physiological relevance. The deletion strategy should precisely remove the US27 open reading frame without disrupting regulatory elements of adjacent genes, particularly US28, which shares sequence homology and is proximally located. Confirmation of successful deletion requires multiple validation approaches: PCR verification of the targeted deletion, whole-genome sequencing to confirm the absence of compensatory mutations elsewhere in the viral genome, and protein expression analysis using US27-specific antibodies. Control viruses should include both wild-type and revertant strains (where the deleted gene is restored) to confirm phenotypic changes are directly attributable to US27 loss. Additionally, researchers should verify that the deletion does not affect virion assembly or initial infection rates by quantifying particle-to-PFU ratios and measuring immediate-early gene expression. These rigorous controls are necessary to distinguish US27-specific effects from indirect consequences of genetic manipulation .

What techniques are most effective for analyzing US27's impact on CXCR4 signaling pathways?

Analysis of US27's impact on CXCR4 signaling pathways requires a multi-modal approach combining molecular, cellular, and functional techniques. For transcriptional regulation studies, chromatin immunoprecipitation (ChIP) assays targeting NRF-1 binding to the CXCR4 promoter, coupled with luciferase reporter assays using wild-type and mutated ARE elements, can establish the direct molecular mechanisms. Protein-protein interactions between US27 and potential signaling partners can be investigated using co-immunoprecipitation, proximity ligation assays, or FRET/BRET approaches to capture transient interactions. For downstream signaling events, researchers should employ phosphoprotein arrays or phospho-specific antibodies to map activation of various pathways (JAK/STAT, MAPK, PI3K/AKT) following CXCL12 stimulation in the presence or absence of US27. Calcium flux assays using fluorescent indicators like Fura-2AM provide quantitative measures of immediate signaling responses. Functional outcomes can be assessed through chemotaxis assays in transwell chambers with varying CXCL12 gradients, while longer-term effects should be evaluated using 3D migration assays in extracellular matrix models that better recapitulate physiological conditions. Finally, inhibitor studies using pathway-specific blockers can help delineate the relative contribution of different signaling cascades to US27-enhanced CXCR4 function .

How can single-cell approaches advance our understanding of US27 function during infection?

Single-cell methodologies offer powerful approaches to decipher the heterogeneous effects of US27 during HCMV infection. Single-cell RNA sequencing (scRNA-seq) of infected cultures can reveal cell-to-cell variability in response to US27 expression, potentially identifying distinct cellular subpopulations with differential susceptibility or response patterns. This approach could also uncover cell type-specific US27-dependent transcriptional programs that might be masked in bulk analyses. Complementary single-cell protein analyses using mass cytometry (CyTOF) or spectral flow cytometry with antibodies against viral proteins and cellular signaling molecules can map the temporal dynamics of US27-induced signaling at the individual cell level. Live-cell imaging using fluorescently tagged US27 and CXCR4 proteins enables real-time visualization of receptor trafficking, co-localization, and membrane dynamics throughout the viral replication cycle. For functional studies, microfluidic systems combining chemotactic gradients with single-cell tracking algorithms can quantify how US27 modulates individual cell migration behaviors in response to CXCL12. These single-cell approaches are particularly valuable for understanding viral factors like US27 that may have context-dependent functions varying with infection stage, cell type, or microenvironment, potentially revealing new therapeutic targets or biomarkers of HCMV pathogenesis .

Comparative Analysis of US27 Functional Properties

Based on the available research evidence, the following table summarizes the key functional properties of US27 compared to other HCMV-encoded GPCR homologs:

PropertyUS27US28UL33UL78
Evolutionary distributionPrimate CMVs onlyPrimate CMVs onlyPrimate and rodent CMVsPrimate and rodent CMVs
Effect on CXCR4 signalingEnhancesImpairsImpairsImpairs
Constitutive signalingNot observedYes (activates IP3, NF-κB, CREB)Yes (activates NF-κB)Not observed
Known ligandsOrphan receptorMultiple chemokines (CCL2, CCL5, CX3CL1)Orphan receptorOrphan receptor
Role in viral disseminationSupports extracellular spreadPromotes cell-to-cell spreadContributes to in vivo replicationMinimal impact on replication
Virion incorporationPresent in virionsPresent in virionsLimited evidenceLimited evidence
Impact on host gene expressionActivates NRF-1/ARE pathwayActivates multiple transcription factorsLimited evidenceLimited evidence

This comparative analysis highlights US27's unique properties among viral GPCR homologs, particularly its enhancement of CXCR4 signaling and support for extracellular viral spread, suggesting specialized roles during HCMV infection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.