Recombinant Human cytomegalovirus G-protein coupled receptor homolog US28 (US28)

Shipped with Ice Packs
In Stock

Description

Functional Roles in HCMV Lifecycle

US28 is expressed during both lytic and latent phases of HCMV infection, with distinct roles in each phase .

Latency Maintenance:

  • MIEP repression: US28 suppresses the major immediate early promoter (MIEP) by attenuating c-fos expression, reducing AP-1 transcription factor binding to the MIEP .

  • Host-cell modulation: Sustained US28 expression silences lytic replication genes, securing latent infection in myeloid cells .

Reactivation Mechanisms:

  • Gαq/11 signaling: Drives phospholipase C-β (PLC-β) activation, increasing inositol trisphosphate (IP3) and calcium flux to prime reactivation .

  • β-arrestin recruitment: Facilitates clathrin-mediated endocytosis and NF-κB activation, promoting viral gene expression .

Table 2: Key Signaling Pathways Activated by US28

PathwayOutcomeRole in HCMV Lifecycle
PLC-β/IP3Calcium mobilizationLytic reactivation
NF-κB/AP-1Pro-inflammatory gene activationImmune evasion, latency
RhoGEFCytoskeletal remodelingViral spread

Mutational Analysis:

  • R129A mutation: Disrupts G-protein coupling, abolishing PLC-β signaling and impairing reactivation in CD34+ hematopoietic progenitor cells .

  • ΔN mutation: Eliminates chemokine binding but retains constitutive activity, confirming ligand-independent signaling .

Cell-Type-Specific Effects:

  • Smooth muscle cells: US28 enhances migration via CCL5/CCL2 binding .

  • Glioblastoma cells: Constitutively activates PLC-β without agonist stimulation .

Therapeutic Targeting Strategies

US28’s role in viral persistence makes it a prime target for antiviral therapies:

Small-Molecule Inhibitors:

  • VUF2274: Inverse agonist that blocks constitutive NF-κB signaling and reactivates latent virus .

  • PCL-β inhibitors: Suppress US28-driven calcium signaling, reducing viral reactivation .

Table 3: Therapeutic Candidates Targeting US28

CompoundMechanismStage of Development
VUF2274Inverse agonistPreclinical
Rho kinase inhibitorsBlock US28-RhoGEF interactionsExperimental

Challenges and Future Directions

  • Ligand promiscuity: US28’s broad chemokine binding complicates selective targeting .

  • Structural plasticity: Cryo-EM studies reveal conformational flexibility, necessitating dynamic drug design approaches .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preferred format when placing the order, and we will fulfill it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
US28; G-protein coupled receptor homolog US28; HHRF3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Human cytomegalovirus (strain Towne) (HHV-5) (Human herpesvirus 5)
Target Names
US28
Target Protein Sequence
MTPTTTTAELTTEFDYDEDATPCVFTDVLNQSKPVTLFLYGVVFLFGSIGNFLVIFTITW RRRIQCSGDVYFINLAAADLLFVCTLPLWMQYLLDHNSLASVPCTLLTACFYVAMFASLC FITEIALDRYYAIVYMRYRPVKQACLFSIFWWIFAVIIAIPHFMVVTKKDNQCMTDYDYL EVSYPIILNVELMLGAFVIPLSVISYCYYRISRIVAVSQSRHKGRIVRVLIAVVLVFIIF WLPYHLTLFVDTLKLLKWISSSCEFERSLKRALILTESLAFCHCCLNPLLYVFVGTKFRQ ELHCLLAEFRQRLFSRDVSWYHSMSFSRRSSPSRRETSSDTLSDEVCRVSQIIP
Uniprot No.

Target Background

Function
This protein serves as a receptor for C-C type chemokines. It binds to MIP-1 alpha, RANTES, and MCP-1, subsequently triggering signal transduction by elevating intracellular calcium ion levels. US28 may regulate viral latency or reactivation and could represent a potential pathway for virally transformed cell proliferation.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Host cell membrane; Multi-pass membrane protein.

Q&A

What is the role of US28 in HCMV latency?

US28 is required for both the establishment and long-term maintenance of HCMV latency. The protein modulates host-cell proteins to suppress viral processes associated with active/lytic replication, thereby promoting latent infection. Research has demonstrated that US28 protein (pUS28) provided in trans complements the US28Δ lytic phenotype in myeloid cells, suggesting that sustained US28 expression is necessary for maintaining long-term latency. This mechanism represents a critical viral strategy for persistence within host cells of the hematopoietic compartment .

How does US28 suppress viral reactivation at the molecular level?

US28 suppresses viral reactivation by repressing transcription from the major immediate early promoter (MIEP), which is essential for initiating lytic replication. This repression occurs within 24 hours of infection but requires continual pUS28 expression to be maintained. At the molecular level, pUS28-mediated signaling attenuates both the expression and phosphorylation of cellular fos (c-fos), an AP-1 transcription factor subunit. By disrupting AP-1 function, US28 prevents this transcription factor from binding to the MIEP and activating lytic gene expression. Comparative studies show that US28Δ infection results in increased AP-1 binding to the MIEP compared with wild-type latent infection .

What experimental models are appropriate for studying US28 function?

The most appropriate experimental models for studying US28 function include:

Model SystemApplicationsAdvantagesLimitations
Myeloid Cell Lines (e.g., THP-1)Latency studiesPhysiologically relevantMay not fully recapitulate primary cells
Primary CD34+ Hematopoietic ProgenitorsNatural latency reservoirMost physiologically relevantTechnical complexity, donor variability
Recombinant Viral SystemsManipulating US28 expressionAllows for precise genetic manipulationMay introduce artifacts
Trans-complementation SystemsProviding US28 protein exogenouslyAllows for temporal control of US28 expressionMay not reflect natural protein levels

When designing experiments to study US28, researchers should consider the cellular context, as US28 functions differently in various cell types. Myeloid lineage cells represent the most physiologically relevant model for examining US28's role in latency establishment and maintenance .

How do signaling pathways influenced by US28 differ between latent and lytic HCMV infection?

US28 exhibits context-dependent signaling properties that differ substantially between latent and lytic infection states. During latency, US28 predominantly signals through pathways that suppress MIEP activity, particularly by attenuating AP-1 function. This involves modulation of c-fos expression and phosphorylation. Experimental approaches to investigate these differences should include:

  • Temporal phosphoproteomics analysis comparing WT and US28Δ infected cells

  • ChIP-seq analysis of transcription factor binding to the MIEP under various infection conditions

  • Signalome analysis using pathway-specific reporter constructs

Researchers should implement experimental designs that allow for direct comparison between latent and lytic conditions while controlling for variables such as cellular differentiation state, infection dose, and time post-infection. Signaling pathway analysis should incorporate both canonical and non-canonical GPCR signaling measurements to fully characterize US28's functional impact .

What are the experimental considerations for studying US28 trans-complementation in latency models?

When studying US28 trans-complementation in latency models, researchers must consider several methodological aspects:

Experimental ConsiderationMethodological ApproachCritical Control
Timing of pUS28 deliveryPre-infection vs. post-infectionMock-transfected controls
Expression levelsTitratable expression systemsQuantification relative to WT viral infection
Protein functionalitySignaling-deficient mutantsParallel assessment of signaling pathway activation
Cellular localizationSubcellular fractionation and imagingConfirmation of membrane localization
Duration of expressionInducible/repressible systemsTime-course analysis of latency markers

The experimental design should include rigorous controls to distinguish between effects of US28 expression and potential artifacts of the trans-complementation system. Researchers must verify that delivered pUS28 reproduces the signaling properties and subcellular distribution of virally-encoded US28. Additionally, time-course experiments are essential to determine whether continuous pUS28 expression is required for maintaining MIEP repression over extended periods .

How can contradictory findings regarding US28 function be reconciled through experimental design?

Contradictory findings regarding US28 function can arise from variations in experimental systems, cell types, and analytical methods. To reconcile such contradictions, researchers should implement:

  • Multi-model validation approaches that test hypotheses across different experimental systems

  • Standardized infection protocols with precisely defined MOI and infection efficiency measurements

  • Comprehensive time-course analyses to capture dynamic changes in US28 function

  • Direct comparison of primary cells with cell lines in parallel experiments

  • Genetic complementation with point mutants to dissect specific functional domains of US28

What are the optimal approaches for measuring US28-mediated repression of the MIEP?

Optimal approaches for measuring US28-mediated repression of the MIEP include multiple complementary techniques:

TechniqueMeasurementAdvantagesConsiderations
RT-qPCRIE gene transcriptionQuantitative, sensitiveRNA quality critical
Reporter AssaysMIEP-driven luciferase/GFPReal-time monitoring possibleMay not reflect chromatin context
ChIP-qPCRTranscription factor bindingDirect measurement of protein-DNA interactionAntibody specificity crucial
Western BlotIE protein expressionDirect measurement of proteinLess sensitive than transcriptional assays
Single-cell AnalysisCell-to-cell variationCaptures population heterogeneityTechnically challenging

An optimal experimental design would combine these approaches to provide multi-level confirmation of US28's effects. Importantly, researchers should include appropriate controls, such as US28Δ virus and pharmacological inhibition of c-fos, to validate that observed effects are specifically attributable to US28-mediated signaling. Time-course analyses are essential to distinguish between effects on MIEP establishment versus maintenance .

How should researchers design experiments to investigate the interaction between US28 and AP-1 transcription factors?

To investigate the interaction between US28 and AP-1 transcription factors, researchers should implement a multi-faceted experimental design:

  • Chromatin Immunoprecipitation (ChIP) assays to measure AP-1 binding to the MIEP during WT versus US28Δ infection

  • Electrophoretic Mobility Shift Assays (EMSA) to assess AP-1 complex formation on MIEP oligonucleotides

  • Co-immunoprecipitation studies to identify potential direct interactions between pUS28 and AP-1 components

  • Phosphorylation-specific western blotting to analyze c-fos activation state

  • AP-1 reporter assays to measure functional activity in the presence or absence of US28

These approaches should be implemented across relevant time points post-infection to capture the dynamics of US28's effects on AP-1. Additionally, researchers should employ pharmacological inhibitors or activators of AP-1 to determine whether manipulation of this pathway is sufficient to overcome or mimic US28-mediated effects on viral latency .

What quasi-experimental designs are appropriate for studying US28 in primary cells with limited sample availability?

When working with primary cells where sample availability is limited, researchers should consider specialized quasi-experimental designs:

  • Single-case reversal designs: These designs involve baseline measurement (A), treatment application (B), and treatment removal (A) phases. For US28 studies, this might involve:

    • Phase A: Measure MIEP activity in primary cells infected with WT virus

    • Phase B: Introduce US28 inhibitor or US28-blocking antibody

    • Phase A: Remove inhibitor/antibody and measure return to baseline

  • Multiple-baseline designs: These are appropriate when complete reversal is not possible, as is often the case with viral infection studies:

    • Stagger the introduction of US28-modulating interventions across different cell samples

    • Compare the timing of changes in dependent variables relative to when the intervention was introduced

  • Pre-post designs with matched controls: When randomization is not possible due to sample limitations:

    • Match samples based on donor characteristics

    • Apply treatment to one sample and compare outcomes

These quasi-experimental approaches can yield valuable insights despite limitations in sample availability or randomization. Researchers should carefully document all potential confounding variables and implement statistical controls to strengthen internal validity .

How should researchers analyze time-course data to distinguish between US28's roles in establishment versus maintenance of latency?

Analyzing time-course data to distinguish between US28's roles in establishment versus maintenance of latency requires specialized analytical approaches:

  • Change-point analysis: Identify statistically significant shifts in MIEP activity or latency markers over time

  • Longitudinal mixed-effects modeling: Account for repeated measures while testing for interactions between US28 status and time

  • Functional data analysis: Treat entire expression trajectories as the unit of analysis rather than individual time points

  • Principal component analysis of temporal profiles: Reduce dimensionality of time-course data to identify major patterns of variation

A methodological approach to this question would involve collecting data at multiple time points (1, 3, 7, 14, and 28 days post-infection) and comparing:

  • WT infection (continuous US28 expression)

  • US28Δ infection (no US28 expression)

  • Conditional US28 expression (present during establishment but removed during maintenance)

  • Delayed US28 expression (absent during establishment but present during maintenance)

This factorial design allows researchers to decouple US28's roles in these distinct phases of latency .

What statistical approaches are appropriate for analyzing the heterogeneity in US28 expression and function across cell populations?

Cellular heterogeneity in US28 expression and function requires specialized statistical approaches:

Statistical ApproachApplicationAdvantagesImplementation
Single-cell analyticsCharacterizing population distributionsCaptures rare cellular statesFlow cytometry, single-cell RNA-seq
Mixture modelingIdentifying subpopulationsQuantifies proportion of responsive cellsBayesian hierarchical modeling
Cellular barcodingTracking clonal responsesLinks initial state to outcomeLentiviral barcode libraries
Spatial statisticsAnalyzing tissue distributionCaptures microenvironmental effectsMultiplexed imaging, spatial transcriptomics
Bootstrapping methodsRobust inference with small samplesNon-parametric, handles outliersResampling with replacement

When analyzing heterogeneous populations, researchers should avoid simply reporting mean values, which can obscure important biological variation. Instead, full distribution data should be presented, and statistical tests should account for multimodality. Single-cell approaches are particularly valuable for identifying potential cellular factors that influence US28 function across the population .

How can researchers effectively control for confounding variables when studying US28's effects on latency in primary cells?

Controlling for confounding variables when studying US28 in primary cells requires rigorous methodological approaches:

  • Donor-matched experimental designs: Use cells from the same donor for different experimental conditions to control for genetic background

  • Cell subset purification: Isolate specific cell populations (e.g., CD34+ progenitors) to minimize heterogeneity

  • Multivariate regression: Statistically adjust for measured confounders in analysis

  • Propensity score matching: Match samples on probability of responding to US28 based on baseline characteristics

  • Instrumental variable approaches: Identify natural variables that affect US28 but not outcomes except through US28

When reporting results, researchers should explicitly document:

  • Donor demographic information

  • Cell isolation and purification methods

  • Passage number and culture conditions

  • Infection efficiency measurements

  • Comprehensive measurement of potential confounding variables

Additionally, researchers should implement sensitivity analyses to assess how robust findings are to unmeasured confounding variables. This might involve simulating the potential impact of confounding of various strengths to determine how strong a confounder would need to be to nullify observed associations .

What are the most promising approaches for therapeutically targeting US28 to prevent HCMV reactivation?

Based on current understanding of US28's role in maintaining HCMV latency, several therapeutic approaches show promise:

Therapeutic ApproachMechanismAdvantagesResearch Challenges
Small molecule US28 antagonistsBlock constitutive signalingPotential oral bioavailabilityAchieving specificity vs. human GPCRs
Allosteric modulatorsModify US28 signaling without blockingMay maintain beneficial effectsComplex signaling interactions
Targeted protein degradationInduce selective US28 degradationComplete removal of proteinDelivery to latently infected cells
Gene editing approachesDisrupt US28 gene or functionPermanent modificationOff-target effects, delivery
Immunotherapeutic targetingDirect immune response to US28-expressing cellsSelective clearanceLimited cell surface expression

Researchers investigating these approaches should implement parallel assays measuring both viral reactivation and cell viability to identify therapeutic windows. Combination approaches that simultaneously target US28 and other viral maintenance factors may prove most effective at disrupting latency while minimizing the potential for viral escape mechanisms .

How might US28 functional properties be leveraged for developing new experimental tools in GPCR research?

US28's unique properties as a viral GPCR offer opportunities for developing novel experimental tools:

  • Constitutive signaling probes: Engineer US28-based biosensors that report on constitutive GPCR activity

  • Chimeric receptor systems: Create fusion proteins combining US28's constitutive domains with other GPCR signaling domains

  • Viral vector delivery systems: Exploit US28's abilities to target specific cell populations for research tool delivery

  • Selective cell marking: Develop US28-based reporter systems to identify and track latently infected cells

  • Signal pathway interrogation: Use US28's multi-pathway engagement to develop pathway-specific inhibitor screening platforms

Methodologically, researchers developing these tools should implement systematic domain-swap experiments, combinatorial mutagenesis approaches, and high-throughput functional screening to identify the most useful configurations. Validation should include side-by-side comparison with existing technologies to benchmark performance and identify unique advantages .

What methodological best practices should researchers follow when publishing studies on US28?

To ensure reproducibility and rigor in US28 research, investigators should adhere to these methodological best practices:

  • Detailed reporting of viral strains: Document the complete provenance and construction of WT and US28Δ viruses

  • Standardized infection protocols: Report MOI, infection efficiency, and virus purification methods

  • Comprehensive cell characterization: Document cell source, passage number, and authentication methods

  • Multiple complementary assays: Validate key findings through orthogonal experimental approaches

  • Time-course measurements: Include temporal dynamics rather than single time-point analyses

  • Appropriate statistical analyses: Report effect sizes, confidence intervals, and multiple testing corrections

  • Data sharing: Provide access to raw data, analysis code, and detailed protocols

Additionally, researchers should explicitly discuss limitations of their experimental systems and how these might impact interpretation of results. When contradictions with existing literature arise, authors should propose specific experimental approaches to resolve discrepancies rather than simply noting differences .

How can researchers effectively integrate US28 studies with broader investigations of HCMV latency mechanisms?

Integrating US28 studies within the broader context of HCMV latency research requires thoughtful experimental design:

  • Multi-factor experimental matrices: Design studies that simultaneously manipulate US28 and other latency factors

  • Systems biology approaches: Implement network analyses that place US28 within larger signaling and regulatory networks

  • Comparative viral studies: Examine US28 alongside homologous GPCRs from other herpesviruses

  • Host-pathogen interaction mapping: Systematically identify all cellular partners of US28 during different infection phases

  • Translational research bridges: Connect basic US28 mechanisms to clinical observations of latency and reactivation

Methodologically, researchers should implement both reductionist approaches (focusing on specific US28 mechanisms) and holistic approaches (examining how US28 functions within the context of the complete viral genome and host cell environment). This integrated perspective will yield the most comprehensive understanding of US28's role in HCMV latency .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.