Recombinant Human cytomegalovirus Membrane glycoprotein UL144 (UL144)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Cytomegalovirus Membrane Glycoprotein UL144 (UL144)

The UL144 open reading frame, found in clinical isolates of human cytomegalovirus (HCMV), encodes a structural homologue of the herpesvirus entry mediator, a member of the TNF receptor (TNFR) superfamily . UL144 is a type I transmembrane glycoprotein expressed early after infection of fibroblasts, but it remains intracellularly . A YXXZ motif in the cytoplasmic tail contributes to its subcellular distribution . It is expressed during latent infection in myeloid lineage cells like CD34+ and CD14+ monocytes .

Detection of Antibodies Specific to UL144

Specific antibodies (Abs) to UL144 can be detected in the serum of HCMV seropositive individuals, including those infected with HIV . Clinical status or antiviral therapy may contribute to waning Ab levels in some patients . Variation in reactivity may depend on specific serologic reaction with different UL144 variants, which is supported by sequence diversity observed in the ectodomain of UL144 .

UL144's Role in Immune Evasion

UL144 contributes to HCMV's ability to escape immune clearance . Its inability to bind any identified TNF family ligands or induce signaling events akin to known TNFRs suggests an intracellular mechanism of action, differing from other known immune evasion strategies . The intracellular localization of UL144 is reminiscent of the poxvirus T2 protein, a TNFR homologue, which functions biologically as a host range restriction factor to allow for productive viral replication in lymphocytes .

UL144 and Endoplasmic Reticulum (ER) Reorganization

UL148, another HCMV glycoprotein, reorganizes the ER during infection, requiring the integrated stress response (ISR) . Since ER reorganization accompanies UL148's roles in modulating HCMV cell tropism and evading antiviral immune responses, these results may have implications for understanding the mechanisms involved .

UL144 Gene Polymorphisms in Congenital HCMV Infection

Ultrasonographic findings in congenital HCMV infection include cerebral ventriculomegaly and echogenic bowel (see Table 1) .

UL144 and GATA-2 Transcription Factor

The viral UL144 gene is expressed during latent infection in CD34+ and CD14+ monocytes, depending on functional GATA-2 transcription factor binding sites in the UL144 promoter . The HCMV latency-associated transcriptome may be virus isolate specific and dependent on the repertoire of transcription factor binding sites in the promoters of latency-associated genes .

UL144 Structure

UL144 likely plays multiple roles in regulating immunity to CMV infection . UL144 shows unique interactions with BTLA residues Gln-43, Lys-41, Ser-121, Leu-74, and Thr-77 that were not observed in the HVEM–BTLA complex (Fig. 4 C) . The two N-terminal β-strands found in HVEM are replaced by a long loop in UL144 (Fig. S2 A and Fig. 5 A), leading to different interactions in that region .

Data Collection and Refinement Statistics for UL144–BTLA Complex

Data collection statisticsUL144–BTLA complex
PDB code6NYP
Space groupP2 1
Cell dimension
a, b, c, (Å)66.9, 77.2, 101.7
α, β, γ (°)90.00, 91.67, 90.00
Resolution range (Å) (outer shell)40–2.7 (2.77–2.70)
No. of unique reflections55,679 (4085)
R meas (%)16.4 (388)
Multiplicity53.6 (53.3)
Average I/σ26.9 (1.45)
Completeness (%)99.5 (97.9)
Refinement statistics
No. of atoms5508
Protein5391
Water56
Glycerol/Na/sulfate/ N-glycans61
Ramachandran plot (%)...

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
UL144; HHV5wtgp119; Membrane glycoprotein UL144; TNF alpha-like receptor UL144; UL144 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-176
Protein Length
full length protein
Species
Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)
Target Names
UL144
Target Protein Sequence
KVCQHNEVQLGNECCPPCGLGQRVTKVCTERTSVTCTPCPNGTYVSGLYNCTDCTQCNVT QVMIRNCTSTNNTVCAPKNHTYFSTPGVQHHKQRQQNHTAHITVKQGKSGRHTLAWLSLF IFLVGIILLILYLIAAYRSERCQQCCSIGKIFYRTL
Uniprot No.

Target Background

Function

Recombinant Human cytomegalovirus Membrane glycoprotein UL144 (UL144) activates NF-κB in a TRAF6-dependent manner, leading to upregulation of the chemokine CCL22.

Gene References Into Functions
References: Functional Studies of UL144
  1. Studies in B, T, and NK cell lines suggest that HVEM and UL144 bind a common BTLA epitope, both in cis and trans interactions. (HVEM = human herpes virus entry mediator; UL144 = membrane glycoprotein UL144 of Human herpesvirus 5; BTLA = human B- and T-lymphocyte attenuator) PMID: 29061848
  2. UL144 gene expression is observed during latent infection in CD34(+) and CD14(+) monocytes, demonstrating UL144 protein functionality in latently infected monocytes. PMID: 23365437
  3. While IE86 represses UL144-mediated activation of a synthetic NF-κB promoter, it does not block UL144-mediated activation of the CCL22 promoter; this resistance to IE86 appears CREB-regulated. PMID: 18287226
  4. No statistically significant correlation was found between UL146 and UL144 genotypes and congenital HCMV disease or sequelae. PMID: 18556037
  5. TRIM23 plays a novel role specific to UL144-mediated NF-κB activation during viral infection. PMID: 19176615
Database Links

KEGG: vg:3077471

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is UL144 and what is its fundamental role in HCMV biology?

UL144 is a membrane glycoprotein encoded by HCMV that functions as a structural mimic of the tumor necrosis factor receptor superfamily member HVEM (herpesvirus entry mediator). Unlike HVEM, which binds multiple ligands including LIGHT, LTα, BTLA, CD160, and gD, UL144 has evolved to exclusively bind BTLA (B and T lymphocyte attenuator), an inhibitory co-receptor that suppresses T-cell activation .

UL144 appears to have multiple immunomodulatory roles during HCMV infection. It can induce production of CCL22 (a macrophage-derived chemokine) via TRAF6-mediated NF-κB signaling to enhance Th2 responses. Additionally, UL144 exhibits anti-inflammatory properties by evading CD160-mediated activation of NK cells . These multiple functions suggest UL144 plays a crucial role in establishing viral persistence by regulating host immunity during CMV infection.

How is UL144 structurally organized and how does this relate to its function?

The crystal structure of UL144 (PDB code 6NYP) reveals that it consists primarily of two cysteine-rich domains (CRDs):

  • CRD1: This N-terminal domain is primarily responsible for BTLA binding. UL144 employs residues exclusively from this region to form the interaction interface with BTLA through hydrophilic and polar contacts, with additional charged salt bridges and hydrophobic interactions .

  • CRD2: The N-terminal CRD2 region of UL144 contains two extended anti-parallel β-strands connected by a short loop that together replace the long C-shaped loop found in HVEM. This structural difference appears to be driven by the differing lengths of CRD2 between UL144 and HVEM .

UL144 also contains a membrane extension region (residues 96-132) that links the ectodomain to the membrane, although this region shows greater flexibility and was not resolved in crystal structures .

What sequence variability exists among UL144 genes from different HCMV clinical isolates?

Sequence analysis of the UL144 ORF in 45 low-passage clinical isolates has demonstrated significant strain-specific variability . Phylogenetic analysis of these sequences revealed three major sequence groups with distinct patterns:

  • Group 1: Includes the Toledo reference strain and can be further divided into three subgroups:

    • Subgroup 1A: 11 strains differing from Toledo by no more than 7 nucleotides out of 531

    • Subgroup 1B: 4 strains differing from Toledo by 15-20 nucleotides

    • Subgroup 1C: 4 strains differing from Toledo by 16-31 nucleotides

  • Group 2: Consists of 3 strains with 74-77 nucleotide substitutions relative to Toledo

  • Group 3: Includes 24 strains differing from Toledo by over 100 nucleotides

Interestingly, a significant proportion of these nucleotide substitutions (50-65% depending on group) are nonsynonymous, resulting in amino acid changes concentrated in the 5' half of the gene .

What methods are available for detecting UL144 in clinical samples?

Researchers have developed several approaches for detecting UL144:

  • PCR amplification: Different primer pairs target specific regions of the UL144 gene. The UL144-B primer pair flanking the complete ORF successfully amplified products from all 45 clinical strains in one study, while the UL144-A primer pair targeting internal sequences was less reliable due to sequence variability at primer binding sites .

  • UL144 IgG ELISA: A multiplexed enzyme-linked immunosorbent assay has been developed for serological detection of anti-UL144 antibodies. This assay uses purified recombinant UL144 proteins coated on microtiter plates to detect IgG responses to different sequence variants (A, B, and C groups) .

  • Southern blot analysis: Using radiolabeled PCR products as probes, this technique can detect UL144 sequences in DNA extracted from infected cells. EcoRI restriction digests typically show a single large fragment hybridizing with UL144-specific probes .

How is recombinant UL144 typically produced for research applications?

Production of recombinant UL144 for research purposes involves several key steps:

  • Expression systems: UL144 can be expressed in either mammalian cells (HEK293T) or insect cells (Sf9). Mammalian expression yields heavily glycosylated protein, while insect cell expression results in reduced glycosylation, which is advantageous for structural studies .

  • DNA construction: The coding sequence is typically cloned into expression vectors with appropriate tags (such as a C-terminal hexahistidine tag) for purification .

  • Transfection/infection: For mammalian expression, DNA and transfection reagents (e.g., ExpiFectamine 293) are mixed and added to cells. For insect cell expression, recombinant baculoviruses are typically used .

  • Purification: The expressed protein is purified from cell culture supernatants using affinity chromatography (Ni-NTA column) followed by size-exclusion chromatography. Sample purity is evaluated using gradient SDS-PAGE gels, and protein concentration is determined by Bradford assay .

  • Optimization for structural studies: For crystallization, researchers have generated N-linked glycosylation site mutants to reduce flexible glycans that might impede crystal formation .

How does the crystal structure of the UL144-BTLA complex inform potential therapeutic development?

The crystal structure of the UL144-BTLA complex reveals unique interactions that could be exploited for therapeutic design:

  • Binding interface characteristics: The UL144-BTLA binding interface buries approximately 881 Ų on BTLA and 832 Ų on UL144. This interface is dominated by hydrophilic and polar contacts with additional charged salt bridges and hydrophobic interactions .

  • Key interaction differences: UL144 shows unique interactions with BTLA residues (Gln-43, Lys-41, Ser-121, Leu-74, and Thr-77) that were not observed in the HVEM-BTLA complex. These differences arise partly because the two N-terminal β-strands found in HVEM are replaced by a long loop in UL144 .

  • Therapeutic implications: Structure-guided mutagenesis has revealed specific hot spots within the UL144-BTLA interaction that could be optimized to design superior BTLA agonists with potential as anti-inflammatory therapeutics .

  • Group-specific binding differences: The group 3 protein (UL144-Fiala) shows modestly enhanced BTLA binding compared with representative groups 1 and 2 proteins, suggesting sequence variants could have different immunomodulatory potentials .

The structural data is captured in this crystallographic dataset:

Data collection statisticsUL144–BTLA complex
PDB code6NYP
Space groupP2 1
Cell dimension
a, b, c, (Å)66.9, 77.2, 101.7
α, β, γ (°)90.00, 91.67, 90.00
Resolution range (Å) (outer shell)40–2.7 (2.77–2.70)
No. of unique reflections55,679 (4085)
R meas (%)16.4 (388)
Multiplicity53.6 (53.3)
Average I/σ26.9 (1.45)
Completeness (%)99.5 (97.9)

What experimental considerations are important when optimizing UL144 ELISA assays?

Several critical factors must be considered when developing and optimizing UL144 ELISA assays:

  • Plate selection: Different microplate types can significantly affect assay performance. Researchers should evaluate multiple plate options to determine optimal binding and signal-to-noise ratios .

  • Coating antigen concentration: Determining the optimal concentration of UL144 protein for coating is critical. This typically involves testing serial dilutions of the antigen to establish the concentration that provides maximum sensitivity without excessive background .

  • Background noise reduction: Various blocking agents and buffer compositions should be tested to minimize non-specific binding and background signals .

  • Serum dilution optimization: Sample dilution factors must be determined empirically to ensure signals fall within the linear range of detection while maximizing sensitivity .

  • Multiplex testing: When testing for antibodies against different UL144 sequence variants (A, B, and C), optimizing the combination and concentration of coating antigens is essential for balanced detection across variants .

  • Assay threshold determination: Receiver operating characteristic (ROC) curve analysis should be used to establish appropriate cutoff values that maximize sensitivity and specificity .

  • Validation parameters: Comprehensive validation should include assessments of specificity, reliability, reproducibility, and the effects of long-term storage of pre-coated plates .

How do the different sequence groups of UL144 potentially affect HCMV pathogenesis?

The significant sequence variability observed in UL144 may have important implications for HCMV pathogenesis:

  • Functional consequences: The high rate of nonsynonymous substitutions (50-65% depending on the sequence group) suggests selection pressure and potential functional diversity among UL144 variants .

  • Binding affinity differences: Group 3 UL144 proteins show modestly enhanced BTLA binding compared to groups 1 and 2, which could result in different levels of immunosuppression during infection .

  • Immune recognition: Sequence variability may affect recognition by host antibodies, potentially allowing escape from previously established immunity. This is particularly relevant considering that the UL144 sequence differences are concentrated in the 5' half of the gene .

  • Strain virulence: Although not directly demonstrated in the available research, differences in immunomodulatory capabilities among UL144 variants could potentially contribute to strain-specific differences in HCMV virulence and clinical outcomes.

  • Evolutionary implications: The distinct grouping of UL144 sequences suggests distinct evolutionary paths that may reflect adaptation to different host environments or transmission patterns .

What are the key considerations for designing site-directed mutagenesis experiments targeting UL144-BTLA interactions?

When designing site-directed mutagenesis experiments to investigate UL144-BTLA interactions, researchers should consider:

  • Interface hot spots: Focus on residues identified in the crystal structure as critical for the binding interface. Key UL144 residues that interact with BTLA include those from the CRD1 region .

  • Comparative approach: Target amino acid positions that differ between UL144 and HVEM, particularly those that create unique interactions with BTLA residues (Gln-43, Lys-41, Ser-121, Leu-74, and Thr-77) .

  • Group-specific differences: Target residues that differ between the three major UL144 sequence groups to understand how sequence variation affects binding affinity and specificity .

  • Glycosylation sites: Consider the role of N-linked glycosylation sites in protein folding, stability, and function. Mutations of these sites may be necessary for structural studies but could affect functional properties .

  • Expression system selection: Choose between mammalian and insect cell expression systems based on experimental goals. Mammalian expression provides native glycosylation patterns but may complicate structural studies, while insect cell expression reduces glycosylation but may alter some functional properties .

  • Functional readouts: Develop appropriate assays to measure the effects of mutations on BTLA binding affinity and downstream signaling events to correlate structural changes with functional consequences.

What approaches can resolve contradictory data regarding UL144's immunomodulatory functions?

Research into UL144's immunomodulatory functions has sometimes yielded seemingly contradictory results. To resolve these contradictions, consider the following approaches:

  • Sequence variant-specific analysis: Always characterize and report which UL144 sequence group/variant is being studied, as different variants may have different functional properties .

  • Comprehensive immune cell panel: Examine effects on multiple immune cell types (T cells, B cells, NK cells, dendritic cells) since UL144 may have cell type-specific effects .

  • Context-dependent signaling: Consider that UL144 may have different effects depending on the cellular environment and cytokine milieu. For example, while UL144 can induce CCL22 production to enhance Th2 responses, it can also be anti-inflammatory by evading CD160-mediated activation of NK cells .

  • Temporal analysis: Examine the kinetics of UL144-mediated effects, as some may be transient or depend on the stage of infection or immune response.

  • In vitro versus in vivo discrepancies: Acknowledge limitations of in vitro systems. For instance, one study found that kidney transplant patients who acquired primary CMV infection developed robust γ-interferon responses to CMV peptides including UL144, but UL144-stimulated T cells did not exhibit antiviral activity, suggesting factors beyond IFN-γ may be important to the anti-CMV immune response .

  • Combinatorial effects: Consider that UL144 likely functions in concert with other viral immunomodulatory proteins rather than in isolation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.