Recombinant Human cytomegalovirus Membrane protein UL121 (UL121)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Cytomegalovirus Membrane Protein UL121 (UL121)

Recombinant Human cytomegalovirus (HCMV) membrane protein UL121 is a component of the HCMV genome, which plays a crucial role in viral replication and pathogenesis. HCMV is a member of the herpesvirus family and is known for causing significant morbidity, particularly in immunocompromised individuals and neonates. The UL121 gene, along with its neighboring gene UL120, is part of the major immediate-early (MIE) region of the virus, which is essential for initiating viral replication and modulating host cell responses.

Function and Regulation of UL121

The UL121 protein is involved in the early stages of viral infection, contributing to the regulation of viral gene expression. Research has shown that microRNAs (miRNAs) encoded by HCMV, such as miR-UL112-1, can regulate the expression of UL121 by targeting its 3′ untranslated region (3′UTR) . This regulation is crucial for controlling viral replication and ensuring efficient infection.

GeneFunctionRegulation
UL121Involved in early stages of viral infection, contributing to viral gene expression regulationRegulated by miR-UL112-1 through its 3′UTR

Research Findings

Studies on HCMV have highlighted the complex interactions between viral proteins and host cell machinery. While specific research on UL121 is limited, its role within the MIE region suggests it is important for viral replication. The UL121 gene is often studied in conjunction with UL120, as both are part of the same transcriptional unit and may encode exons within the MIE family of transcripts .

MicroRNA Regulation

The regulation of UL121 by miR-UL112-1 demonstrates the sophisticated mechanisms HCMV employs to control its life cycle. This miRNA targets multiple viral genes, including UL121, to modulate viral replication and ensure optimal infection conditions .

Potential Applications and Future Research

Understanding the functions of UL121 and its regulation by miRNAs can provide insights into developing novel therapeutic strategies against HCMV. Targeting specific viral genes or their regulatory elements could offer new avenues for antiviral drug development.

Therapeutic Potential

Research into the specific roles of UL121 and other MIE region genes could lead to the development of targeted therapies that disrupt viral replication by interfering with these critical regulatory processes.

Future Directions

Further studies are needed to elucidate the precise mechanisms by which UL121 contributes to HCMV infection and to explore its potential as a therapeutic target. This could involve investigating the effects of UL121 expression on viral replication in different cell types and exploring how miRNA regulation impacts viral pathogenesis.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UL121; Membrane protein UL121
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-180
Protein Length
Full Length of Mature Protein
Species
Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Target Names
UL121
Target Protein Sequence
TYICSPNPGRLRISCALSVLDQRLWWEIQYSSGRLTRVLVFHDDGEEGGDLHLTDTRHCT SCTHPYVISLVTPLTINATLRLLIQDGMYGRGEKELCIAHLPTLRDIRTCRVDADLGLLY AVCLILSFSIVAAALWKVDYDRSVAVGPKSYKS
Uniprot No.

Target Background

Protein Families
HHV-5 UL121 protein family
Subcellular Location
Host membrane; Single-pass type I membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.