Recombinant Human cytomegalovirus Membrane protein US14 (US14)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant US14

Recombinant US14 is a full-length, His-tagged viral membrane protein expressed in E. coli . It corresponds to amino acids 1–310 of the HCMV US14 protein (UniProt ID: F5HD92) and is utilized to investigate HCMV’s interactions with host immune systems . HCMV US14 belongs to the US12 gene family, which modulates host cell surface proteins to evade natural killer (NK) cell recognition .

Functional Role in HCMV Pathogenesis

US14 is part of the HCMV US12 gene family (US12–US21), which collectively downregulates immune ligands to evade NK cell detection . Key findings include:

  • Immune Evasion: US14 contributes to suppressing NK cell activation by modulating cell surface proteins, though its specific targets are less characterized than US18 and US20 .

  • Synergistic Activity: US14 operates alongside US16, US18, and US20 to regulate proteins like B7-H6 (an NKp30 ligand) and adhesion molecules . Deletion of US14–16 did not restore B7-H6 expression, suggesting overlapping roles with other US12 family members .

Proteomic Insights

  • A multiplexed proteomics study quantified ~1,300 plasma membrane proteins in HCMV-infected cells. US14 deletion altered surface expression of immune ligands, though its individual impact was less pronounced than US18/US20 .

  • In ARPE19 cells, HCMV lacking the US14–22 genomic region failed to downregulate B7-H6, implicating US14 in broader immune modulation networks .

Cell-Type Specificity

  • US14 deletion mutants replicated normally in human fibroblasts (HFF) and retinal pigment epithelial cells (RPE) but exhibited enhanced growth in microvascular endothelial cells (HMVEC), hinting at cell-type-specific immune evasion roles .

Applications in Research

Recombinant US14 enables:

  1. Mechanistic Studies: Elucidating how HCMV manipulates host immune responses.

  2. Antiviral Development: Screening inhibitors targeting US12 family proteins.

  3. Structural Biology: Analyzing viral membrane protein interactions via crystallography or cryo-EM.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time information, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us. We will prioritize the development of your specified tag.
Synonyms
US14; Membrane protein US14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)
Target Names
US14
Target Protein Sequence
METVSTQRETASSETERTREAASAETTDATFRSLEEGSTISSRYSETASTASEDAVCWLR RTAIVMRVYGLLTLETAFSVLISALVWLGYPSLGYECRDDPSPLLLSCTPVLVLGALELT DHRHPSNGLVFALYVALLSFTTAGLNLCATAPIGVSSLILTWTLFVACNGVAWEHRLSSV WRDALFTSTLLTVMVSVLASTYTWLHKTLLCLYTVFVGCILAVLFQDVRYIATKMPVSHI IRSSLVLYATETLIYHTTLLMLTPVVWSARWDQMFSYLAKLGTYHHYRVDNGTLSVILNS TTATFQSRVA
Uniprot No.

Target Background

Database Links

KEGG: vg:3077456

Protein Families
Cytomegalovirus US12 family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is Human Cytomegalovirus US14 protein and where is it encoded?

US14 is a membrane protein encoded by Human Cytomegalovirus (HCMV) within the US12 gene family, which consists of ten sequentially arranged genes (US12-21) located in the unique short (US) region of the HCMV genome. This protein consists of 310 amino acids and is highly hydrophobic in nature . The US14 gene is part of a complex regulatory region in the HCMV genome that encodes multiple immunomodulatory functions . The protein has been classified as part of a significant immunoregulatory hub within the viral genome, contributing to HCMV's sophisticated immune evasion strategies .

How is US14 structurally and functionally related to other members of the US12 family?

US14 belongs to the US12 family, a set of ten genes (US12-21) arranged in tandem in the HCMV genome. These genes share sequence homology and encode similar multi-pass transmembrane proteins with seven predicted transmembrane domains. The functional relationship between US14 and other family members (particularly US12, US18, and US20) has been established through systematic multiplexed proteomics analysis, revealing their coordinated roles in immune evasion . While individual US12 family members target specific host proteins, they work in concert to comprehensively modulate the host cell surface proteome, particularly focusing on immune recognition molecules . The structural similarities suggest a common evolutionary origin, while functional studies demonstrate both overlapping and distinct roles in viral pathogenesis .

What are the key immunomodulatory functions of US14 during HCMV infection?

US14 functions primarily as an immunomodulatory protein that contributes to HCMV's immune evasion mechanisms. Systematic functional analyses have identified US14 as one of four members of the US12 family (alongside US12, US18, and US20) with novel Natural Killer (NK) cell evasion functions .

The precise mechanisms of US14-mediated immunomodulation involve:

  • Selective targeting of plasma membrane proteins

  • Regulation of NK cell ligands

  • Modulation of adhesion molecules

  • Alteration of cytokine receptor expression

Deletion studies involving the US14-22 genomic region demonstrated that US14 contributes to the virus's ability to downregulate key immune recognition molecules, including B7-H6, a ligand for the NK cell activating receptor NKp30 . This downregulation inhibits NK cell activation, allowing the virus to escape immune recognition and clearance during infection .

How does US14 interact with host cellular machinery to evade immune recognition?

US14 employs sophisticated mechanisms to interact with host cellular machinery for immune evasion:

  • Targeted protein degradation: US14 likely contributes to the extensive modulation of host cells where HCMV downregulates >900 human proteins during viral replication and degrades ≥133 proteins shortly after infection .

  • Selective plasma membrane protein targeting: Multiplexed proteomics analyses have revealed that US14, along with other US12 family members, selectively targets plasma membrane proteins rather than affecting the whole cell proteome indiscriminately .

  • Cooperative function with other viral proteins: US14 works in concert with other US12 family members, particularly in regions containing US14-16, to effectively downregulate immune recognition molecules such as B7-H6 .

  • Transcriptional regulation complexity: The expression of US14 is governed by a complex regulatory mechanism that is not yet fully understood, potentially involving tri-cistronic mRNA containing multiple ORFs .

These interactions collectively contribute to HCMV's ability to establish persistent infection by evading host immune surveillance mechanisms.

What recombinant expression systems are optimal for producing US14 protein for in vitro studies?

For recombinant expression of US14 protein, several systems have proven effective:

  • E. coli expression system: This has been successfully used to produce recombinant full-length His-tagged US14 protein (1-310 amino acids) as evidenced by commercially available research reagents . The bacterial expression system offers high yield but may present challenges with proper folding of this multi-transmembrane domain protein.

  • Mammalian expression systems: For functional studies requiring proper post-translational modifications and folding, mammalian cell lines (typically HEK293T cells) transfected with expression vectors containing the US14 gene sequence are preferred. This approach is particularly important when studying protein-protein interactions or immunological functions .

  • Viral vector systems: Recombinant viral vectors expressing tagged versions of US14 have been employed in interactome studies, allowing expression in the context of viral infection .

When choosing an expression system, researchers should consider:

  • The need for post-translational modifications

  • Proper protein folding requirements

  • The experimental application (structural studies, functional assays, or interaction analysis)

  • The requirement for membrane integration

For studies requiring functional US14 that mimics its native state, mammalian expression systems typically provide the most physiologically relevant results.

What experimental approaches are effective for studying US14 function in the context of viral infection?

Several effective experimental approaches have been developed to study US14 function during HCMV infection:

  • Bacterial Artificial Chromosome (BAC) recombineering: This powerful technique allows precise genetic manipulation of the viral genome, including creation of US14 deletion mutants, point mutations, or tagged versions of the protein . BAC-derived viruses can be reconstituted in tissue culture systems to study the impact of US14 modifications on viral replication and immune evasion.

  • Systematic multiplexed proteomics:

    • Plasma Membrane Profiling (PMP) to identify cell surface targets

    • Tandem Mass Tag (TMT)-based proteomics to quantify ~1300 cell surface and ~7200 whole cell proteins

    • Quantitative Temporal Viromics (QTV) to track >8000 cellular and viral proteins throughout infection

These approaches have been instrumental in defining US14's role in immune evasion by identifying specific host targets and quantifying changes in the cellular proteome during infection .

  • Deletion mutant analysis: Creating HCMV mutants with deletions in US14 alone or in combination with other US12 family genes (e.g., US14-16, US16-18, US17-20) has helped delineate the specific contributions of US14 to immune evasion . Flow cytometry analysis of infected cells can then reveal changes in surface expression of immune recognition molecules.

  • In vivo infection models: Rhesus CMV (RhCMV) models have been developed with reconstituted full-length viral genomes allowing the study of US14 homologs in a more physiologically relevant context .

How can researchers effectively analyze US14 interactions with host proteins?

To effectively analyze US14 interactions with host proteins, researchers can employ several complementary approaches:

  • Mass spectrometry-based interactome analysis: This approach has successfully identified networks of virus-host protein interactions for HCMV proteins. Using tagged, stably-expressed US14 protein in infected cells, researchers can perform immunoprecipitation followed by mass spectrometry to identify specific host protein interactors .

  • Validation techniques for protein-protein interactions:

    • Co-immunoprecipitation (Co-IP): Confirming interactions identified by mass spectrometry

    • Proximity labeling approaches (BioID, APEX)

    • FRET or BRET for studying interactions in living cells

    • Yeast two-hybrid screening for detecting binary protein interactions

  • Domain analysis: Computational prediction of protein-protein interaction domains can guide targeted mutagenesis to disrupt specific interactions .

  • Functional validation: Following identification of potential interactions, researchers should perform functional studies to determine the biological significance:

    • siRNA knockdown of host interaction partners

    • CRISPR/Cas9-mediated knockout of host genes

    • Point mutations in US14 interaction domains

    • Competitive inhibition with peptides or small molecules

These approaches can reveal not only direct binding partners of US14 but also the functional consequences of these interactions for viral immune evasion strategies.

How does US14 function differently across various HCMV strains and clinical isolates?

Research on strain differences in US14 function reveals significant variations that impact viral pathogenesis:

  • Laboratory vs. clinical strains: Laboratory-adapted HCMV strains often contain mutations or deletions in immunomodulatory genes, including the US12 family region. Reconstruction of complete viral genomes has demonstrated that clinical isolates with intact US14 and related genes display enhanced viremia and tissue tropism compared to laboratory strains .

  • Strain-specific genomic variations: Comparisons between different HCMV isolates have revealed that the genomic region containing US14 can vary between strains, potentially affecting immune evasion capabilities . The human cytomegalovirus genome has been extensively revised through comparative analysis with chimpanzee cytomegalovirus, highlighting evolutionary adaptations in immune evasion genes .

  • Clinical implications: Strain-specific variations in US14 and related genes may contribute to differences in viral pathogenesis, tissue tropism, and immune evasion capabilities. For example, the full-length RhCMV (an animal model for HCMV) displays in vitro and in vivo characteristics of a wildtype virus while being amenable to genetic modifications, allowing researchers to study the impact of US14 homologs in various contexts .

  • Tissue-specific functions: Different HCMV strains show variable replication efficiency in different cell types. For instance, deletion mutants in the UL/b' region (which contains genes functionally related to US14) exhibit cell type-specific growth phenotypes , suggesting that US14 may also have tissue-specific functions that vary between strains.

What role does US14 play in HCMV latency and reactivation?

The role of US14 in HCMV latency and reactivation is an emerging area of research with several key findings:

Future research directions should explore US14 expression patterns during latency establishment, maintenance, and reactivation to fully understand its contributions to these critical aspects of HCMV pathogenesis.

How might understanding US14 function contribute to HCMV vaccine or therapeutic development?

Understanding US14 function offers several promising avenues for HCMV vaccine and therapeutic development:

  • Vector-based vaccine approaches:

    • RhCMV vectors have shown remarkable effectiveness in protecting against SIV, Mtb, and Plasmodium knowlesi

    • Understanding US14's role in immune modulation could help design vectors with optimal immunogenicity profiles

    • Controlled attenuation through US14 modification might balance reduced virulence with maintained immunogenicity

  • Targeted antiviral strategies:

    • US14's role in immune evasion makes it a potential target for novel therapeutics

    • Small molecule inhibitors disrupting US14 function could enhance immune recognition of infected cells

    • Peptide-based inhibitors of US14-host protein interactions could restore immune surveillance

  • Biomarkers for viral pathogenesis:

    • US14 expression patterns or polymorphisms might serve as biomarkers for predicting clinical outcomes

    • US14-mediated effects on the host proteome could provide diagnostic signatures of infection severity

  • Improved animal models:

    • The construction of full-length RhCMV BACs with modifiable US14 homologs provides powerful tools for testing vaccines and therapeutics in physiologically relevant models

    • These models allow controlled modulation of tissue tropism, pathogenesis, and immune stimulation through targeted modifications of US14 and related genes

This research has direct applications for developing preventive strategies against congenital CMV infection, a leading cause of deafness and intellectual disability affecting approximately 1/200 pregnancies .

What are the major technical challenges in studying US14 protein function?

Researchers face several significant technical challenges when studying US14 function:

  • Extreme hydrophobicity: US14, like other US12 family members, is extremely hydrophobic with multiple transmembrane domains, making conventional biochemical investigations problematic . This property complicates:

    • Protein purification and solubilization

    • Structural characterization

    • Antibody generation for detection

    • In vitro functional assays

  • Complex regulatory mechanisms: The expression of US14 is governed by sophisticated regulatory mechanisms, potentially involving tri-cistronic mRNAs with other US12 family genes (US18, US19, US20), complicating genetic manipulation approaches .

  • Functional redundancy: US14 often functions in concert with other viral proteins, particularly US12 family members, creating redundancy that can mask phenotypes in single-gene deletion studies .

  • Context-dependent function: US14's activity appears highly dependent on cellular context and the presence of other viral proteins, requiring study in authentic infection models rather than overexpression systems alone .

To address these challenges, researchers have developed specialized approaches including multiplexed proteomics techniques, BAC-based recombineering, and sophisticated interactome analyses that overcome the limitations of traditional biochemical methods .

How can researchers design experimental controls when studying US14 in different cellular contexts?

Designing appropriate experimental controls is crucial when studying US14 across different cellular contexts:

  • Viral mutant controls:

    • Complete deletion mutants (ΔUS14)

    • Point mutants that preserve overlapping reading frames

    • Revertant viruses to confirm phenotype specificity

    • Complementation studies (trans-expression of US14 in deletion mutant infections)

  • Cell type considerations:

    • Multiple cell types should be tested (e.g., fibroblasts, epithelial cells, endothelial cells) as US14 function may be cell type-specific

    • Primary cells versus cell lines (immortalized cells may have altered innate immune responses)

    • Species-specific controls when using animal models (human versus non-human primate cells)

  • Temporal controls:

    • Time-course experiments to capture dynamic changes

    • Comparison across different stages of infection (immediate-early, early, late)

    • Inducible expression systems to study US14 function independent of infection timing

  • Technical validation approaches:

    • Multiple methodologies to confirm findings (e.g., flow cytometry, microscopy, proteomics)

    • Quantitative methods with appropriate statistical analysis

    • Independent biological replicates with consistent conditions

Studies have demonstrated that viral gene functions can vary dramatically in different cell types. For example, specific HCMV mutants show normal replication in some cell types but severely impaired growth in others , highlighting the importance of testing US14 function across multiple cellular contexts.

How should researchers interpret proteomics data in the context of US14 functional studies?

Interpreting proteomics data for US14 functional studies requires careful consideration of several factors:

  • Data normalization and statistical analysis:

    • Appropriate normalization methods to account for technical and biological variation

    • Statistical significance thresholds with multiple testing correction

    • Fold-change cutoffs based on biological relevance, not arbitrary thresholds

  • Experimental design considerations:

    • Comparison between wild-type virus and US14 deletion mutants

    • Time-course analysis to capture dynamic changes

    • Multiple cell types to identify context-dependent effects

    • Plasma membrane profiling versus whole-cell proteome analysis

  • Integration with complementary datasets:

    • Transcriptomics data to distinguish translational from post-translational effects

    • Interactome data to identify direct versus indirect targets

    • Functional assays to validate biological significance

  • Bioinformatic analysis approaches:

    • Pathway enrichment analysis to identify affected cellular processes

    • Protein interaction network analysis to visualize US14's impact

    • Comparison with other viral protein effects to identify unique versus shared targets

The US12 family proteins demonstrate selective targeting of plasma membrane proteins rather than wholesale changes to the cellular proteome , highlighting the importance of focused analysis on relevant protein subsets when interpreting proteomics data for US14 function.

What are the best approaches for distinguishing direct versus indirect effects of US14 on host cell proteins?

Distinguishing direct from indirect effects of US14 on host cell proteins requires multi-faceted experimental approaches:

  • Temporal analysis:

    • Early time points after infection or US14 expression are more likely to reveal direct effects

    • Time-course experiments can track the progression from primary to secondary effects

    • Pulse-chase experiments can identify rapidly versus slowly changing targets

  • Proximity-based methods:

    • BioID or APEX2 proximity labeling to identify proteins in close physical proximity to US14

    • Crosslinking mass spectrometry to capture direct binding partners

    • FRET/BRET assays to detect direct interactions in living cells

  • In vitro binding assays:

    • Purified component binding studies (if technically feasible despite hydrophobicity)

    • Domain mapping to identify specific interaction regions

    • Competition assays with peptides or antibodies to block specific interactions

  • Genetic approaches:

    • Structure-function analysis with US14 mutants to identify domains required for specific effects

    • Rapid induction systems (e.g., tetracycline-inducible expression) to capture immediate effects

    • Domain swapping between US12 family members to identify specificity determinants

Recent interactome analyses of HCMV proteins have successfully identified direct virus-host protein interactions for multiple viral proteins, providing a framework for similar studies with US14 . This approach revealed >3400 virus-host and >150 virus-virus protein interactions, which can help distinguish direct US14 targets from downstream effects in the broader network of viral manipulation of host cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.