Recombinant Human cytomegalovirus Nuclear egress membrane protein (UL50)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
NEC2; UL50; Nuclear egress protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-397
Protein Length
full length protein
Species
Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Target Names
NEC2
Target Protein Sequence
MEMNKVLHQDLVQATRRILKLGPSELRVTDAGLICKNPNYSVCDAMLKTDTVYCVEYLLS YWESRTDHVPCFIFKNTGCAVSLCCFVRAPVKLVSPARHVGEFNVLKVNESLIVTLKDIE EIKPSAYGVLTKCVVRKSNSASVFNIELIAFGPENEGEYENLLRELYAKKAASTSLAVRN HVTVSSHSGSGPSLWRARMSAALTRTAGKRSSRTASPPPPPRHPSCSPTMVAAGGAAAGP RPPPPPMAAGSWRLCRCEACMGRCGCASEGDADEEEEELLALAGEGKAAAAAAGQDVGGS ARRPLEEHVSRRRGVSTHHRHPPSPPCAPSLERTGYRWAPSSWWRARSGPSRPQSGPWLP ARFATLGPLVLALLLVLALLWRGHGQSSSPTRSAHRD
Uniprot No.

Target Background

Function
Recombinant Human cytomegalovirus Nuclear egress membrane protein (UL50) plays a crucial role in virion nuclear egress, the initial step of virion release from infected cells. Within the host nucleus, UL50 interacts with the nascent capsid via its vertices, directing it to the inner nuclear membrane through association with NEC2. It induces capsid budding at the inner nuclear membrane and subsequent envelopment within the perinuclear space. The UL50/NEC2 complex then facilitates fusion of the enveloped capsid with the outer nuclear membrane, releasing the viral capsid into the cytoplasm for transport to secondary budding sites in the Golgi or trans-Golgi network.
Protein Families
Herpesviridae NEC2 protein family
Subcellular Location
Host nucleus inner membrane; Single-pass membrane protein.

Q&A

What is the structural organization of HCMV UL50 protein?

UL50 possesses a strikingly intricate protein fold that is unique among known protein structures. NMR studies of the murine CMV homolog (M50; residues 1-168) revealed a tertiary structure that isn't matched by other known protein folds in its entirety . The protein contains an N-terminal nucleoplasmic domain and a C-terminal transmembrane domain that anchors it to the nuclear membrane . This organization enables UL50 to serve as a multi-interacting scaffold protein that recruits various viral and cellular factors through direct and indirect contacts . The protein's structural sophistication reflects its diverse functional roles during viral infection.

How does UL50 interact with UL53 to form the nuclear egress complex?

The interaction between UL50 and UL53 involves a specific "hook-into-groove" binding mechanism where a conserved peptide segment of UL53 fits into a surface groove on UL50 that contains a large cavity . NMR studies mapped this interaction using a highly conserved UL53-derived peptide corresponding to a segment required for heterodimerization . This interaction serves as the foundational step in NEC assembly and triggers the recruitment of additional viral and cellular factors that participate in nuclear egress .

Point mutations of specific residues in this UL50 binding interface (particularly E56A and L130A) substantially decreased UL50-UL53 binding in vitro, eliminated their colocalization in infected cells, prevented disruption of nuclear lamina, and halted productive virus replication . These findings confirm that the UL50-UL53 heterodimer formation is essential for viral replication and nuclear egress.

What functional domains in UL50 are critical for its various activities?

Several functional domains in UL50 are essential for its diverse activities during viral infection:

  • Transmembrane domain: Located at the C-terminus, this domain anchors UL50 to the ER and inner nuclear membrane . This membrane association is critical not only for proper localization but also for NEC-independent functions such as VCP/p97 degradation, IRE1 downregulation, and UBE1L degradation .

  • UL53-binding domain: Contains a surface groove with a large cavity that forms the interaction interface with UL53 . Key residues in this domain (such as E56 and L130 in HCMV UL50) are essential for NEC formation and function .

  • Regulatory regions: UL50 contains phosphorylation sites that are modified by NEC-associated kinases like pUL97 and cellular CDK1 . Interestingly, recent studies indicate that blocking these phosphorylation events did not significantly impair viral replication, suggesting redundant regulatory mechanisms .

  • Internal methionine at position 199: Serves as an alternative translation initiation site for the expression of UL50-p26, a smaller isoform that regulates full-length UL50 activity . The M199V mutation prevents UL50-p26 expression and affects viral replication kinetics .

What are optimal approaches for expressing and purifying recombinant UL50 for structural studies?

For structural studies of recombinant UL50, researchers should consider these methodological approaches:

  • Domain-based expression: For soluble domains (N-terminal region without transmembrane domain), bacterial expression systems with solubility-enhancing fusion tags (MBP, GST, SUMO) have proven successful. The M50 N-terminal domain (residues 1-168) was expressed in E. coli for NMR structural studies .

  • Full-length protein expression: For the complete protein including the transmembrane domain, mammalian expression systems (HEK293T cells) with viral promoters provide better folding and post-translational modifications . C-terminal epitope tagging (such as HA-tag) allows for effective detection and purification while typically preserving function .

  • Purification considerations:

    • For soluble domains: Standard chromatography methods (affinity, ion exchange, size exclusion)

    • For membrane-bound forms: Detergent solubilization using mild non-ionic detergents (DDM, CHAPS)

    • Co-expression with binding partners like UL53 may enhance stability

  • Quality assessment: Size exclusion chromatography combined with multi-angle light scattering (SEC-MALS) can verify protein homogeneity and oligomeric state, which is critical before proceeding to structural studies.

For optimal results, it's advisable to remove flexible regions that may interfere with crystallization while preserving the core functional domains. NMR spectroscopy has proven particularly valuable for studying UL50 domains and their interactions with binding partners .

How can researchers effectively measure UL50-UL53 interactions in vitro and in cells?

To effectively measure UL50-UL53 interactions, researchers can employ both in vitro biochemical methods and cellular approaches:

In vitro methods:

  • Surface Plasmon Resonance (SPR): Provides quantitative binding kinetics by immobilizing one partner on a sensor chip and measuring real-time association/dissociation of the other partner.

  • NMR spectroscopy: Successfully used to map the interaction interface between M50 (murine homolog of UL50) and a UL53-derived peptide . This approach provides atomic-level details of the interaction.

  • Isothermal Titration Calorimetry (ITC): Measures binding affinity and thermodynamic parameters of protein-protein interactions in solution.

  • Pull-down assays: Using tagged versions of either protein to co-immunoprecipitate interaction partners, followed by detection via Western blotting .

Cellular approaches:

  • Co-immunoprecipitation from infected cells: HA-tagged UL50 has been successfully used to detect interactions with cellular and viral proteins in infected cells .

  • Fluorescence microscopy: Colocalization analysis of UL50 and UL53 at the nuclear rim in infected cells provides evidence of interaction . Mutations that disrupt binding (E56A, L130A) eliminate this colocalization .

  • Fluorescence resonance energy transfer (FRET): Using fluorescently tagged proteins to detect proximity-based energy transfer as a measure of direct interaction.

  • Mutagenesis validation: Point mutations in key interface residues (like E56A and L130A) combined with any of the above methods provide strong validation of specific interaction mechanisms .

What imaging technologies best visualize UL50 localization and function during viral infection?

For visualizing UL50 localization and function, several advanced imaging technologies have proven effective:

  • Confocal laser scanning microscopy: Provides high-resolution imaging of UL50 localization patterns. HA-tagged UL50 has been shown to accumulate at the nuclear rim during late stages of infection (72-96 hours post-infection) . This technique can effectively visualize the transition of UL50 from initial ER localization to the nuclear membrane.

  • Immunogold electron microscopy (Immuno-EM): Offers ultrastructural details of UL50 localization and has been used to analyze changes in nuclear distribution of associated proteins like UL53 and lamin A/C . This approach revealed that deletion of UL50 affects nuclear capsid maturation, with an accumulation of immature A-type capsids .

  • Live-cell imaging with fluorescent protein fusions: Enables temporal tracking of UL50 dynamics during infection. Time-lapse imaging can capture the recruitment of UL53 to the nuclear rim by UL50 and subsequent nuclear membrane modifications.

  • Super-resolution microscopy (STORM, PALM, or SIM): Overcomes the diffraction limit to visualize nanoscale details of UL50 distribution at the nuclear membrane and its colocalization with interaction partners.

Sample preparation considerations include:

  • Fixation method selection: 4% paraformaldehyde for immunofluorescence; glutaraldehyde/paraformaldehyde mixtures for EM

  • Specific antibodies or epitope tags for detection

  • Appropriate co-staining for nuclear lamina components to visualize lamina disruption

How does UL50-p26 regulate full-length UL50 activity during infection?

The UL50-p26 isoform (26-kDa) is an N-terminal truncated form of UL50 expressed from an internal methionine at position 199 during HCMV infection . This smaller isoform plays a sophisticated regulatory role in modulating full-length UL50 activity through several mechanisms:

  • Differential temporal expression: UL50-p26 appears earlier in infection (12h post-infection) than full-length pUL50 (24h), reaches peak levels at 48h, and becomes less abundant than pUL50 at later stages (72-96h) . This temporal pattern suggests a developmentally regulated expression program.

  • Antagonistic regulation of VCP/p97 degradation: UL50-p26 inhibits the ability of full-length pUL50 to induce the loss of valosin-containing protein (VCP/p97) . When UL50-p26 expression is prevented (as in the UL50(M199V) mutant virus), VCP/p97 levels decrease and viral immediate early 2 (IE2) protein expression is delayed .

  • Protein-protein interaction dynamics: UL50-p26 interacts with both full-length pUL50 and VCP/p97, although its interaction with VCP/p97 is weaker than that of full-length pUL50 . The UL50-p26 interaction with pUL50 is substantially stronger than pUL50 self-interaction, suggesting it may sequester pUL50 from VCP/p97 .

  • Impact on viral replication: The UL50(M199V) mutant virus lacking UL50-p26 shows delayed growth, particularly at low multiplicity of infection (MOI) . This indicates that the balanced expression of both isoforms is important for optimal viral replication kinetics.

This regulatory mechanism represents a sophisticated strategy by which HCMV fine-tunes pUL50 activity throughout the infection cycle, highlighting the complex regulation of viral protein function during infection.

What mechanisms underlie UL50's role in disrupting the nuclear lamina?

UL50 orchestrates nuclear lamina disruption through a complex mechanism involving multiple protein interactions and enzymatic activities:

  • NEC formation and scaffolding: UL50 recruits UL53 to the nuclear rim to form the core nuclear egress complex . This heterodimer serves as a platform for recruiting additional factors necessary for nuclear lamina reorganization.

  • Kinase recruitment and activity: The UL50-UL53 complex recruits both viral kinase pUL97 and cellular kinases like CDK1 . These kinases phosphorylate nuclear lamins, a critical modification leading to local disassembly of the nuclear lamina structure.

  • Formation of lamina-depleted areas (LDAs): The phosphorylation of lamins leads to the formation of distinct LDAs where the nuclear lamina is locally disrupted . These areas create access points for viral capsids to reach the inner nuclear membrane.

  • Molecular evidence from mutational studies: Mutations in the UL50-UL53 interaction interface (E56A and L130A) prevent proper NEC formation and subsequently block nuclear lamina disruption . Cells infected with these mutants display oval nuclei and almost intact nuclear lamina comparable to mock-infected cells, in contrast to the deformation, ruffling, and thinning of nuclear lamina observed in wild-type HCMV infection .

  • Additional regulatory factors: The UL50-UL53 complex also recruits factors like the prolyl cis/trans isomerase Pin1, which may contribute to nuclear lamina reorganization through protein conformational changes .

The essential nature of this process is demonstrated by the observation that disruption of UL50-UL53 interaction leads to a complete halt in productive virus replication , confirming that NEC-mediated nuclear lamina disruption is indispensable for HCMV replication.

How does UL50 influence capsid maturation independent of its NEC function?

Beyond its canonical role in the NEC, UL50 appears to influence viral capsid maturation through several NEC-independent mechanisms:

  • Capsid phenotype in UL50 deletion mutants: In the absence of pUL50 expression, studies have detected a strong decrease in the production of mature C-type capsids and an accumulation of immature A-type capsids . This suggests UL50 influences capsid maturation independently of its role in nuclear egress.

  • VCP/p97 regulation: UL50 induces the loss of valosin-containing protein (VCP/p97), which affects viral immediate early gene expression . Changes in viral gene expression patterns may indirectly influence the capsid maturation process by altering the timing or levels of capsid proteins.

  • Impact on viral DNA packaging: Quantitative measurements of encapsidated genomes have demonstrated a substantial reduction in DNA content in ΔUL50N particles (produced in non-complementing cells) compared to ΔUL50C particles (produced in UL50-complementing cells) . This indicates UL50 may influence the DNA packaging process.

  • Proteomics evidence: Mass spectrometry-based quantitative proteomics analyses of ΔUL50 particles have revealed differences in protein composition between particles produced under complementing versus non-complementing conditions , further supporting UL50's influence on virion composition.

  • Unfolded protein response modulation: UL50 downregulates IRE1, affecting the unfolded protein response (UPR) . The UPR plays important roles in cellular protein homeostasis, potentially impacting viral protein folding and capsid assembly.

These findings collectively suggest that UL50 exerts complex regulatory effects on capsid maturation through various mechanisms distinct from its direct role in the nuclear egress complex.

How can UL50 be targeted for antiviral development?

UL50 presents several promising opportunities for antiviral development:

  • Disruption of UL50-UL53 interaction: The well-characterized binding interface between UL50 and UL53 offers a rational target for small molecule inhibitors . The surface groove on UL50 with its large cavity provides a defined binding pocket that could be targeted by structure-based drug design . Point mutations in this interface (E56A, L130A) completely halt viral replication, validating the essential nature of this interaction .

  • Inhibition of membrane association: The transmembrane domain of UL50 is critical for both its NEC-dependent and NEC-independent functions . Compounds that prevent proper membrane insertion or that disrupt the orientation of UL50 within the membrane could effectively inhibit multiple UL50 functions simultaneously.

  • Modulation of UL50-mediated protein degradation: UL50 induces the degradation of several cellular proteins including VCP/p97 and UBE1L . Small molecules that prevent these specific degradation events could potentially restore antiviral mechanisms such as ISGylation and disrupt viral gene expression patterns.

  • Targeting UL50-kinase interactions: UL50 recruits viral and cellular kinases that phosphorylate nuclear lamins . Inhibitors that selectively block these interactions could prevent nuclear lamina disruption without affecting normal cellular kinase functions.

  • Exploitation of UL50 isoform regulation: The regulatory relationship between full-length UL50 and UL50-p26 could be exploited by developing compounds that mimic UL50-p26 binding to full-length UL50, potentially disrupting UL50 function during critical stages of infection .

The conservation of NEC components across herpesviruses suggests that targeting the UL50-UL53 interaction could potentially lead to broad-spectrum antiherpesvirus compounds .

What cellular pathways are modulated by UL50 during infection?

UL50 modulates several critical cellular pathways during HCMV infection:

  • Nuclear architecture and lamina organization: Through its role in the NEC, UL50 initiates profound changes in nuclear morphology, including deformation of nuclear shape, ruffling and thinning of the nuclear lamina, and generation of gaps in the lamina . These structural alterations facilitate nuclear egress but may also impact various nuclear functions.

  • Protein quality control and ER homeostasis: UL50 targets the endoplasmic reticulum through its transmembrane domain and affects ER-associated protein homeostasis . Specifically, it induces the loss of valosin-containing protein (VCP/p97), a key component in ER-associated degradation (ERAD) and numerous other cellular processes .

  • Unfolded protein response (UPR): UL50 downregulates Inositol-requiring enzyme 1 (IRE1), which mediates mRNA splicing of X-box binding protein 1 (XBP1) in the UPR . This interference with UPR signaling may prevent premature cell death and allow sustained viral replication.

  • ISGylation pathway: UL50 inhibits protein modification by ISG15 (ISGylation) by inducing proteasomal degradation of UBE1L, an E1-activating enzyme for ISGylation . This represents an important viral countermeasure against this interferon-stimulated antiviral mechanism.

  • Ubiquitin-proteasome system: UL50 interacts with RNF170, an ER-associated E3 ligase, to promote ubiquitination and degradation of specific cellular targets . This interaction highlights UL50's ability to hijack cellular protein degradation machinery.

These diverse effects on cellular pathways underscore the multifunctional nature of UL50 beyond its canonical role in nuclear egress and explain why this protein is critical for efficient viral replication.

What are the best experimental systems for studying UL50 function in primary HCMV infection?

For studying UL50 function in primary HCMV infection, researchers should consider these optimal experimental systems:

  • Virus engineering approaches:

    • BAC mutagenesis for generating recombinant viruses with precisely controlled modifications to UL50 :

      • Point mutations targeting specific functional domains (e.g., UL50(M199V) to prevent UL50-p26 expression)

      • Epitope tagging (e.g., HA-tagged UL50) for detection and interaction studies

      • Conditional expression systems to control UL50 function temporally

    • Comparison of clinical vs. laboratory-adapted HCMV strains (e.g., Toledo vs. AD169) to account for strain variations

  • Cellular models with increasing physiological relevance:

    • Human fibroblasts: Traditional model for studying HCMV lytic replication

    • Primary epithelial cells and endothelial cells: More representative of natural infection sites

    • 3D organoid cultures: Better recapitulation of tissue architecture and cellular heterogeneity

    • Conditionally immortalized cell lines expressing UL50 for complementation studies

  • Advanced analytical techniques:

    • Multi-parameter flow cytometry to correlate UL50 expression with viral and cellular markers

    • Mass spectrometry-based quantitative proteomics for comprehensive protein interaction mapping

    • Immunogold electron microscopy to examine UL50's role in nuclear architecture reorganization

    • Real-time qPCR-based infection kinetics to measure replication efficiency of UL50 mutants

    • Cryo-electron tomography to visualize nuclear egress events in their native cellular context

  • Complementation strategies:

    • Compare virus particles produced in UL50-complementing (ΔUL50C) versus non-complementing (ΔUL50N) cells to differentiate between incorporation effects and expression effects

    • Domain-specific complementation to identify which UL50 functions are essential at different stages

These experimental systems provide a comprehensive toolkit for investigating the multifaceted functions of UL50 in biologically relevant contexts of primary HCMV infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.