Recombinant Human cytomegalovirus Protein IRL10

Shipped with Ice Packs
In Stock

Description

Characteristics of Recombinant Human Cytomegalovirus Protein IRL10

  • Protein Structure and Glycosylation The putative protein product is a 171-amino-acid glycoprotein with a theoretical mass of 20.5 kDa . In virus-infected cells, two predominant forms of gpTRL10 exist, having molecular masses of 22 and 23.5 kDa, modified by high-mannose sugars .

  • Transcription Kinetics Northern blot analyses indicate that the TRL10 gene is transcribed with early/late kinetics .

  • Structural Component of Virions Immunoblot analyses and immunoelectron microscopy have confirmed that TRL10 is a structural component of the virus particle . Similar to other HCMV envelope glycoproteins, TRL10 exists in a disulfide-linked complex .

  • Strain-Specific Variation Sequence analysis of the TRL10 coding region in low-passage clinical isolates reveals strain-specific variation .

Function and Location

Transiently expressed TRL10 is localized to the endoplasmic reticulum (ER) . The presence of high-mannose carbohydrates on the gpTRL10 in virus-infected fibroblasts suggests that these molecules are likely localized to the ER . Extracellular viral particles contain gpTRL10 modified with complex N-linked sugars .

Viral IL-10 and Immune Modulation

HCMV encodes a viral ortholog (CMVIL-10) of human cellular interleukin-10 (cIL-10) . Although it shares only about 26% amino acid sequence identity with cIL-10, CMVIL-10 exhibits comparable immunosuppressive activity . HCMV uses viral IL-10 proteins to manipulate the immune system during lytic and latent phases of infection .

HCMV IL-10 Isoforms

Multiple isoforms of HCMV viral IL-10 (vIL-10) exist, arising from different UL111A transcripts . These isoforms include vIL-10A, B, C, D, E, and F, each with variations in the C-terminal region, amino acid sequence, and length . Isoforms vIL-10A, E, and F are glycosylated, while B, C, and D are not .

Role in Immune Suppression and Viral Persistence

HCMV IL-10 suppresses cytokine production and inhibits the proliferation of mitogen-stimulated human peripheral blood mononuclear cells . By increasing the expression of cIL-10, HCMV infection helps the virus avoid clearance and facilitates persistence . The LAcmvIL-10-induced increase in cIL10 appears to have an important role in the survival of CD14+ monocytes and CD34+ precursor cells, consequently in the establishment of viral latency in the cells .

Modulation of Host IL-10 Synthesis

HCMV infection significantly increases host IL-10 synthesis . Recombinant cmvIL-10 or culture supernatant of HCMV-infected macrophages directly induces human IL-10 synthesis . Neutralizing antibodies for cmvIL-10 during HCMV infection significantly reduce host IL-10 synthesis, suggesting that cmvIL-10 secreted from HCMV-infected macrophages elicits host IL-10 production .

Impact on Co-infections

HCMV infection dampens the regulatory pathways of interferon-gamma (IFN-γ), tumor necrosis factor-alpha (TNF-α), and interleukin-1 (IL-1), which abrogates immune responses to Mycobacterium massiliense co-infection in macrophages . This provides a mechanistic basis for how HCMV infection may facilitate the development of pathogenic NTM co-infection by upregulating IL-10 expression .

Surface Plasmon Resonance Characterization of RhCMVIL-10/IL-10R1 Interactions

Surface plasmon resonance (SPR) experiments validate that RhcmvIL-10 M1 and M2 exhibit reduced binding to IL-10R1 . The resulting binding constants reveal an initial interaction between RhCMVIL-10 and human IL-10R1 of 65.1 nM (KD1), with a second apparent binding constant, KD2, of 1.3 nM .

Table 1: Binding Constants for RhCMVIL-10/IL-10R1 Interactions

Binding ConstantValue (nM)
KD165.1
KD21.3

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Protein IRL10; TRL10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-171
Protein Length
Full Length of Mature Protein
Species
Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Target Protein Sequence
TKVATNCLVKSENTHLTCKCSPNNTSSNTGNGSKCHAMCKCRITEPITMLGAYSAWGAGS FVATLIVLLVVFFVIYAREEEKNNTGTEVDQCLAYRSLTRKKLEQHAAKKQNIYERIPYR PSRQKDNSPLIEPTGTDDEEDEDDNV
Uniprot No.

Target Background

Protein Families
HHV-5 RL10 protein family
Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

What is HCMV IL-10 and how is it generated?

HCMV IL-10 refers to a family of viral proteins encoded by the UL111A gene that function as homologs of cellular IL-10. The UL111A gene undergoes alternative splicing to produce multiple transcripts. The most well-characterized are cmvIL-10 (isoform A) and LAcmvIL-10 (isoform B), but additional isoforms (C through G) have been identified in cells infected with laboratory-adapted HCMV strains. Despite having only 27% sequence identity with human IL-10, cmvIL-10 preserves the structural conformation necessary to bind to the IL-10R1 receptor with comparable affinity to its cellular counterpart .

What are the known isoforms of HCMV IL-10 and when are they expressed?

To date, seven isoforms (A-G) plus a newly identified isoform H have been documented, though their expression varies depending on the infection model. In MRC-5 fibroblasts infected with the HCMV TB40E strain, transcripts for isoforms A, B, E, and the novel isoform H were detected at various timepoints post-infection. In U251 cells, isoform B was predominant at 24-72 hours, while isoform F was detected at 72 hours post-infection. The expression pattern of these isoforms appears to be cell type-specific and time-dependent during the viral replication cycle .

How do the functional properties of HCMV IL-10 isoforms differ?

The isoforms demonstrate distinct functional profiles. Isoform A (cmvIL-10) possesses broad immunosuppressive activities similar to cellular IL-10, while isoform B (LAcmvIL-10) exhibits more restricted biological functions, primarily inhibiting transcription of MHC class II biosynthesis components. This functional divergence appears related to structural differences affecting receptor binding and downstream signaling. The functional properties of isoforms C through G and the newly identified isoform H remain largely uncharacterized .

What approaches are effective for detecting HCMV IL-10 transcript expression?

Nested PCR has proven effective for detecting UL111A transcripts in infected cells. When analyzing expression patterns, time-course experiments are essential as different isoforms appear at distinct timepoints post-infection. For example, in MRC-5 cells, transcripts A and B were detected at 24, 48, and 96 hours post-infection but not at 72 hours, while transcript E was detected only at 48 and 96 hours. This temporal variation necessitates comprehensive sampling throughout the infection cycle to accurately profile the expression dynamics .

How can the structure-function relationship of HCMV IL-10 isoforms be studied?

Molecular modeling combined with functional analysis has proven valuable for understanding the structure-function relationship of HCMV IL-10 isoforms. Key approaches include:

  • Homology modeling based on crystallographic structures

  • Molecular dynamics simulation to evaluate protein flexibility

  • Normal-mode analysis to identify potential receptor binding sites

  • Docking simulations to predict protein-receptor interactions

These in silico approaches have revealed that specific amino acids in helix A, the AB loop, and helix F (including ARG27, LYS34, GLN38, SER141, ASP144, and GLU151 in cmvIL-10) are likely critical for binding to IL-10R1 .

What methodologies can determine the binding affinity between HCMV IL-10 and the IL-10 receptor?

Researchers can employ several complementary approaches to assess binding affinity:

  • Co-immunoprecipitation experiments to detect protein-protein interactions

  • Surface plasmon resonance to measure binding kinetics

  • Isothermal titration calorimetry for thermodynamic analysis

  • Cell-based assays measuring downstream signaling events

These methods can reveal differences in receptor binding properties among isoforms. For instance, molecular dynamics and docking simulations have demonstrated that HCMV IL-10 isoforms form complexes with IL-10R1 that exhibit different molecular interactions, resulting in varying affinities and stabilities .

What is the relationship between HCMV IL-10 and other viral immunoevasins?

HCMV encodes multiple immunoevasins that target different aspects of the host immune response. While HCMV IL-10 primarily mimics cellular IL-10 to suppress immune function, other viral proteins like US10 target HLA class I molecules. US10 recognizes and binds to all HLA-I heavy chains (HLA-A, -B, -C, -E, -G) but affects them differently: HLA-A mostly escapes downregulation, tapasin-dependent HLA-B molecules show impaired maturation, and certain HLA-C allotypes are strongly retained in the endoplasmic reticulum. This demonstrates how HCMV employs multiple, complementary strategies to evade both innate and adaptive immunity .

How might structural variations in HCMV IL-10 isoforms be exploited for therapeutic development?

Understanding the structural determinants of HCMV IL-10 binding to IL-10R1 presents opportunities for therapeutic intervention. The key receptor-binding residues identified in helix A (ARG27, LYS34, GLN38) and helix F (SER141, ASP144, GLU151) represent potential targets for structure-based drug design. Small molecules or peptides that selectively block these interactions could inhibit the immunosuppressive effects of viral IL-10 without affecting beneficial functions of cellular IL-10. Additionally, differential targeting of specific isoforms could allow for selective interference with viral immune evasion mechanisms .

What are the key structural differences between cmvIL-10 and LAcmvIL-10?

The structural differences between these isoforms explain their distinct functional properties. cmvIL-10 (isoform A) contains 175 amino acids and maintains a conformation that enables binding to IL-10R1 with an affinity similar to cellular IL-10. In contrast, LAcmvIL-10 (isoform B) consists of 139 amino acids and has a truncated C-terminal region. This truncation affects its three-dimensional structure, potentially altering its interaction with IL-10R1 and explaining its more restricted immunomodulatory capabilities compared to cmvIL-10 .

How does the receptor binding profile of HCMV IL-10 compare across different isoforms?

Molecular modeling suggests significant differences in receptor binding profiles among isoforms. While cmvIL-10 maintains key receptor-binding residues in both N-terminal (ARG27, LYS34, GLN38) and C-terminal regions (SER141, ASP144, GLU151), other isoforms show alterations in these critical interaction sites. These structural variations result in complexes with IL-10R1 that exhibit different molecular interactions, affinities, and stabilities, which likely contribute to their distinct immunomodulatory properties .

HCMV IL-10 IsoformSize (amino acids)Detection in TB40E-infected cellsKey Receptor Binding SitesKnown Functions
cmvIL-10 (A)175MRC-5 (24, 48, 96h)Preserved in helix A, AB loop, helix FBroad immunosuppression similar to cIL-10
LAcmvIL-10 (B)139MRC-5 (24, 48, 96h), U251 (24, 48, 72h)Altered due to C-terminal truncationRestricted to inhibition of MHC class II biosynthesis
Isoform ENot specifiedMRC-5 (48, 96h)Predicted differences from molecular modelingLargely unknown
Isoform FNot specifiedU251 (72h)Predicted differences from molecular modelingLargely unknown
Isoform H (novel)Not specifiedMRC-5 and U251 (72h)Not characterizedUnknown

What are the implications of HCMV IL-10 isoforms for viral pathogenesis and latency?

Future research should investigate how the differential expression of HCMV IL-10 isoforms influences viral pathogenesis and establishment of latency. The predominance of LAcmvIL-10 during latent infection suggests a role in maintaining the latent state, possibly by selectively suppressing certain immune functions while allowing others to remain intact. Understanding the regulatory mechanisms governing isoform expression during different phases of infection could provide insights into viral persistence strategies and potential targets for therapeutic intervention .

How might HCMV IL-10 isoforms contribute to strain-specific differences in clinical outcomes?

The expression pattern and functional properties of HCMV IL-10 isoforms may contribute to strain-specific differences in virulence and clinical outcomes. Research comparing UL111A splicing patterns and isoform expression between clinical isolates from patients with different disease manifestations could reveal correlations between specific isoform profiles and pathogenicity. Such studies would benefit from combining transcriptomic analysis with functional assays measuring immunomodulatory effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.