Recombinant Human cytomegalovirus Protein TRL14

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Cytomegalovirus (HCMV) Protein TRL14 is a protein encoded by the TRL14 gene of the human cytomegalovirus (HCMV) . HCMV is a betaherpesvirus that establishes lifelong latent infections in its host and can cause congenital disabilities if a mother is infected during pregnancy . Understanding the function and interactions of TRL14 is crucial for developing effective strategies to combat HCMV infection.

General Information

Creative BioMart offers Recombinant Full Length Human Cytomegalovirus Protein TRL14 Protein, His-Tagged, produced in E. coli . The protein is tagged with His and is the full length, spanning amino acids 1-186 .

Table 1: Recombinant Human Cytomegalovirus Protein TRL14 Product Details

Cat.#Product NameSource (Host)SpeciesTagProtein Length
RFL5437HFRecombinant Full Length Human Cytomegalovirus Protein Trl14 Protein, His-TaggedE. coliHHV5HisFull Length (1-186)

Function

HCMV Protein TRL14 has several biochemical functions, some of which are performed in cooperation with other proteins, while others are enacted by TRL14 itself .

Involvement in Pathways

Cytomegalovirus protein TRL14 is involved in several pathways and plays different roles in them .

Protein Interactions

TRL14 directly interacts with other proteins and molecules, as detected through methods like yeast two-hybrid assays, co-immunoprecipitation (co-IP), and pull-down assays .

HCMV and Immune Evasion

HCMV employs various mechanisms to evade the host's immune system. US11, another HCMV protein, attacks a specific receptor that improves immunity and directs protective antibodies from the mother to the fetus, impairing the receptor and potentially reducing the transmission of critical antibodies .

Potential Therapeutic Applications

Beyond prevention of birth defects and immune system dysfunction, there is a potential treatment benefit for autoimmune diseases . US11 can facilitate antibody degradation and suppress antibody function, so it could potentially be used to treat autoimmune diseases and target disease-causing antibodies, indirectly benefiting patients with immune disorders like lupus where the immune response causes the disease .

HCMV Vaccine Development

Various vaccine strategies have been developed, including live attenuated vaccines and recombinant viral proteins . Chimeric vaccine candidates have been produced by recombining the genomes of the Towne strain and the unattenuated HCMV Toledo strain to yield independent chimeric vaccine candidates . These vaccine candidates were well tolerated and did not cause systemic infection, warranting additional human trials .

Identification of HCMV Proteins

A comprehensive quantitative analysis of viral and cellular proteins that compose infectious particles of a large complex virus identified 12 HCMV-encoded polypeptides not previously associated with the virion, including TRL14 .

Inhibitors of HCMV

Five structurally unique and selective HCMV inhibitors were identified, active at sub to low μM concentrations, and each compound inhibited a specific stage of HCMV replication . MLS8554 was active in most antiviral assays inhibiting HCMV, GCV-R HCMV, HSV1&2 and MCMV, with maximal activity measured at immediate early to early time after infection, reducing IE2, UL44, UL84 and pp65 protein levels .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
Protein TRL14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Target Protein Sequence
MRPQLRGNQRNRIRWWQHNSKKCNQTEKWHNVDWIHYEYPTHKMCELGNYHQTTPRHDIC FDCNDTSLTIYNLTTRNAGKYTRHHRDNGQEENYYVTVLIGDTTLSTLGTCPVRYKESRN TENTIGSNIIKTIEKANIPLGIHAVWAGVVVSVALIALYMGSHRIPKKPHYTKLPKYDPD EFWTKA
Uniprot No.

Target Background

Protein Families
RL11 family
Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

How is TRL14 protein detected in HCMV virions?

TRL14 can be detected in purified HCMV virions through several complementary approaches:

  • Mass spectrometry analysis: Using gel-free two-dimensional capillary liquid chromatography-tandem mass spectrometry (LC-MS/MS) and Fourier transform ion cyclotron resonance (FTICR). This technique identified TRL14 peptides in purified virion samples with a sequence coverage of 7.5% .

  • Proteomic workflow:

    • Virus purification through sequential sedimentation and density ultracentrifugation

    • Denaturation of proteins (typically using 8M urea)

    • Tryptic digestion of the denatured proteins

    • Fractionation by cation exchange chromatography

    • LC-MS/MS or FTICR analysis

    • Validation using database search algorithms such as SEQUEST

When analyzing virion composition, high-purity virus preparations are essential as cellular contaminants can confound results. Electron microscopy validation of virus preparations is recommended before proteomic analysis .

What is the immunological significance of TRL14 in HCMV infection?

TRL14 represents one of the most significant HCMV antigens recognized by the human immune system, particularly by CD4+ T cells. Key findings include:

  • TRL14 is among the 10 most frequently recognized antigens by CD4+ T cells during HCMV infection

  • While gB-specific CD4+ T cell responses are most frequently detected in healthy individuals (>30%), some individuals (<5%) show higher numbers of precursors specific for TRL14

  • The strong CD4+ T cell response to TRL14 suggests its potential utility in vaccine development and immunotherapeutic approaches

Methodologically, TRL14-specific T cell responses can be measured using:

  • FluoroSpot or ELISPOT assays with TRL14 peptide pools

  • Intracellular cytokine staining following peptide stimulation

  • MHC class II tetramer analysis for specific epitopes

Researchers should consider measuring both IFN-γ and IL-10 responses to gain a complete picture of the functional T cell response .

How is recombinant TRL14 protein expressed and purified for research applications?

Recombinant TRL14 is typically expressed in E. coli expression systems with an N-terminal His tag to facilitate purification. The expression and purification workflow includes:

  • Expression system: E. coli is the most common host for TRL14 expression

  • Vector construction: The TRL14 gene (1-186aa) is cloned into an expression vector with a His tag

  • Induction conditions: Optimized temperature, IPTG concentration, and induction time

  • Purification: Affinity chromatography using Ni-NTA or similar matrices

  • Quality control: SDS-PAGE to confirm purity (>90% purity is typically achieved)

Final preparation is often supplied as a lyophilized powder for extended shelf stability. For reconstitution, researchers should use deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol recommended for long-term storage .

What are the optimal storage conditions for recombinant TRL14 protein?

To maintain the biological activity and stability of recombinant TRL14 protein, the following storage conditions are recommended:

  • Long-term storage: Store lyophilized protein at -20°C to -80°C

  • Reconstituted protein: Store at 4°C for up to one week

  • Aliquoting: For multiple use, divide into small aliquots to avoid repeated freeze-thaw cycles

  • Buffer composition: Tris/PBS-based buffer with 6% trehalose at pH 8.0 is optimal for lyophilized storage

  • Glycerol addition: Add glycerol to a final concentration of 50% for reconstituted protein stored at -20°C

Experimental data indicates that repeated freeze-thaw cycles significantly decrease protein activity, making proper aliquoting essential for maintaining protein functionality across multiple experiments .

What experimental techniques are suitable for studying TRL14 function?

Several approaches can be employed to investigate TRL14 function:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation assays

    • Yeast two-hybrid screening

    • Proximity labeling techniques (BioID or APEX)

    • Pull-down assays using His-tagged recombinant TRL14

  • Cellular localization studies:

    • Immunofluorescence microscopy with anti-TRL14 antibodies

    • Subcellular fractionation followed by Western blotting

    • Live-cell imaging with fluorescently tagged TRL14

  • Functional assays:

    • T cell activation assays using TRL14 peptides or recombinant protein

    • Viral growth curve analysis in cells overexpressing or depleted of TRL14

    • Chromatin immunoprecipitation for detecting potential interactions with host chromatin

  • Structural analysis:

    • Crystallography or cryo-EM for tertiary structure determination

    • Circular dichroism for secondary structure analysis

    • HDX-MS for conformational dynamics

These approaches can be used individually or in combination to gain comprehensive insights into TRL14 function in the context of HCMV infection .

How can researchers analyze the TRL14-specific T cell response in HCMV infection?

Analysis of TRL14-specific T cell responses requires methodological rigor. The recommended workflow includes:

  • Sample preparation:

    • Isolation of peripheral blood mononuclear cells (PBMCs) from HCMV-seropositive donors

    • Enrichment of CD4+ T cells using magnetic separation if needed

  • Stimulation conditions:

    • Use overlapping peptide pools spanning the entire TRL14 sequence

    • Include appropriate positive controls (e.g., PHA, SEB) and negative controls

    • Typical incubation period: 16-18 hours for ELISPOT/FluoroSpot assays

  • Detection methods:

    • FluoroSpot assay for simultaneous detection of multiple cytokines (e.g., IFN-γ and IL-10)

    • Flow cytometry for phenotypic characterization (CD45RA, CD27, CCR7 expression)

    • Intracellular cytokine staining for functional analyses

  • Data analysis:

    • Define positive response threshold (e.g., >100 spot-forming units/million cells)

    • Compare responses across different age groups and donors

    • Correlate with viral control in clinical settings if applicable

Studies have shown that TRL14-specific responses persist throughout the lifespan of HCMV-seropositive individuals, without significant expansion with increasing age, in contrast to some other HCMV antigens .

What is the role of TRL14 in HCMV virion structure and function?

TRL14 has been identified as a glycoprotein component of the HCMV virion, with several important structural and functional implications:

  • Virion localization: Proteomics studies have categorized TRL14 as a virion glycoprotein, suggesting it may be present on the virion envelope or tegument

  • Abundance in virions: Quantitative proteomics indicates that TRL14 is present in lower abundance compared to major structural proteins like pp65 (UL83), but is consistently detected in purified virion preparations

  • Differential presence: Interestingly, TRL14 was detected in HCMV virions but not in dense bodies (virus-like particles lacking capsids and viral DNA), suggesting a potential role specific to infectious particles

  • Functional significance: While the exact function remains to be fully elucidated, its consistent presence in virions across different HCMV strains suggests an important role in the viral life cycle

Research approaches to further investigate TRL14's role in virion structure include immuno-electron microscopy, virion fractionation studies, and creation of TRL14-deleted recombinant viruses to assess impacts on viral assembly and infectivity .

What is known about TRL14's role in HCMV latency and reactivation?

The role of TRL14 in HCMV latency and reactivation is an active area of research. Current understanding includes:

  • Expression during latency: Studies using next-generation sequencing approaches have analyzed the transcriptome of latently infected CD14+ and CD34+ cells. While some viral transcripts have been identified during latency (such as RNA4.9, RNA2.7, UL84, and UL44), TRL14 transcription during latency remains less characterized .

  • Potential immune evasion functions: TRL14's strong immunogenicity suggests it may play a role during reactivation phases. Some viral proteins with high immunogenicity also possess immune evasion functions to counterbalance host recognition.

  • Research approaches for latency studies:

    • Chromatin immunoprecipitation (ChIP) followed by next-generation sequencing to identify protein-DNA interactions during latency

    • RNA-seq of latently infected cells to detect potential TRL14 transcription

    • FAIRE (Formaldehyde Assisted Isolation of Regulatory Elements) analysis to identify nucleosome-depleted viral DNA regions that may regulate TRL14 expression

    • In vitro latency models using CD14+ monocytes or CD34+ cells

Researchers investigating TRL14's role in latency should consider both experimental and natural latency settings to validate findings .

How does TRL14 compare to other immunodominant HCMV proteins in research applications?

TRL14 represents one of several immunodominant HCMV proteins recognized by CD4+ T cells. Comparative analysis with other HCMV proteins reveals:

Viral ProteinCell Type ResponseRelative ImmunodominancePresence in VirionResearch Applications
TRL14CD4+ T cellsHigh in <5% of individualsYes (glycoprotein)Immunological studies, Virion structure
pp65 (UL83)CD8+ and CD4+ T cellsHighly immunodominantYes (most abundant tegument)Diagnostic assays, Vaccine candidates
gB (UL55)CD4+ T cells>30% of individualsYes (envelope)Vaccine development, Neutralizing antibody studies
IE1CD8+ T cellsHighNoLatency studies, T cell immunotherapy
pp71CD4+ T cellsVariable (with notable IL-10 response)Yes (tegument)Immunomodulatory studies

For research applications:

  • TRL14 may be particularly valuable for studying CD4+ T cell responses in specific individuals with strong TRL14 recognition

  • When developing comprehensive immune monitoring assays, inclusion of TRL14 alongside more universally recognized antigens like pp65 and gB is recommended

  • For vaccine development, TRL14 might represent a complementary antigen to include for broader population coverage

What methodological considerations are important when using recombinant TRL14 for structure-function studies?

When conducting structure-function studies with recombinant TRL14, researchers should consider:

  • Protein folding verification:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Limited proteolysis to evaluate conformational integrity

    • Size exclusion chromatography to detect aggregation

  • Post-translational modifications:

    • E. coli-expressed TRL14 will lack mammalian glycosylation patterns

    • For studies requiring glycosylated TRL14, consider mammalian or insect cell expression systems

    • Evaluate the impact of His-tag on protein function; consider tag removal for certain applications

  • Functional domain mapping:

    • Generate truncation mutants to identify functional domains

    • Site-directed mutagenesis of conserved residues

    • Chimeric proteins with related viral proteins to determine specificity

  • Biophysical characterization:

    • Differential scanning fluorimetry to assess thermal stability

    • Surface plasmon resonance for interaction kinetics

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Experimental controls:

    • Include inactivated/denatured TRL14 as negative control

    • Use related viral proteins as specificity controls

    • Validate findings across multiple experimental systems

These methodological considerations will help ensure robust and reproducible findings in structure-function studies of TRL14 .

How can researchers investigate TRL14's interaction with the host immune system?

To investigate TRL14's interactions with the host immune system, consider these methodological approaches:

  • T cell epitope mapping:

    • Overlapping peptide libraries spanning TRL14 sequence

    • ELISPOT or intracellular cytokine staining to identify stimulatory peptides

    • HLA restriction analysis using blocking antibodies or matched/mismatched APCs

    • Confirmation with synthesized minimal epitopes

  • Antigen presentation studies:

    • Pulse dendritic cells with recombinant TRL14 and co-culture with T cells

    • Track intracellular processing using fluorescently labeled TRL14

    • Inhibit specific processing pathways to determine processing requirements

  • Functional consequences of T cell recognition:

    • Cytokine profiling (both Th1 and Th2 cytokines)

    • Cytotoxicity assays against TRL14-expressing targets

    • Proliferation assays to assess T cell expansion

  • In vitro viral control models:

    • Co-culture TRL14-specific T cells with infected cells

    • Measure viral dissemination using reporter viruses

    • Compare effectiveness of TRL14-specific T cells with T cells targeting other viral antigens

Research has shown that CD4+ T cells specific to HCMV proteins can directly control viral replication through both cytotoxic and cytokine-mediated mechanisms, suggesting TRL14-specific T cells may similarly contribute to viral control .

What are the latest research developments regarding TRL14's role in HCMV pathogenesis?

Recent research developments regarding TRL14's role in HCMV pathogenesis include:

  • Immune recognition patterns:

    • TRL14 has been identified as one of the 10 most frequently recognized HCMV antigens by CD4+ T cells

    • Unlike some HCMV-specific T cell responses that accumulate with age, TRL14-specific responses appear to be maintained without significant expansion in older donors

    • TRL14 recognition shows individual variation, with high precursor frequencies in a subset of donors

  • Virion incorporation:

    • Comprehensive virion proteomics has confirmed TRL14 as a component of infectious virions but not dense bodies

    • Its classification as a glycoprotein suggests potential roles in virion structure or host cell interactions

  • Research limitations and future directions:

    • A comprehensive understanding of TRL14's specific function remains elusive

    • Further studies utilizing targeted mutagenesis, structure determination, and in vivo models are needed

    • Integration of TRL14 findings with broader HCMV immunobiology may reveal its significance in pathogenesis

Future research should focus on determining TRL14's precise function in viral replication, potential immune evasion activities, and its contribution to viral pathogenesis in different host tissues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.