Recombinant Human cytomegalovirus Transmembrane protein HWLF3 (US20)

Shipped with Ice Packs
In Stock

Description

Topology and Localization

  • Membrane Topology: US20 adopts a 7TMD configuration with an N-terminal cytosolic orientation and a C-terminal luminal ER orientation .

  • Post-Translational Modifications:

    • Partial N-glycosylation at Asn242 (EndoH-sensitive) .

    • Accumulates in ER-derived peripheral structures outside the cytoplasmic virus assembly compartment (cVAC) .

Role in HCMV Replication

US20 is dispensable for viral replication in fibroblasts but essential in endothelial cells :

Cell TypeReplication Phenotype of US20-Null Mutants
FibroblastsNormal growth kinetics (multi- and single-step)
Endothelial Cells>4-log reduction in viral titers
Epithelial CellsNo significant defect

Mechanism of Action:

  • Post-Entry Requirement: US20 sustains replication after viral entry but before early (E) gene expression and DNA synthesis .

  • Transcriptional Dysregulation: US20-deficient viruses fail to express E/L mRNAs (e.g., UL44, UL99) and proteins in endothelial cells .

Experimental Use Cases

  • Protein-Protein Interaction Studies: Used to map US20’s interaction with host factors in endothelial cells .

  • Antiviral Target Screening: Evaluated for inhibitors targeting HCMV endothelial tropism .

Technical Advantages

  • High-Yield Production: Bacterial expression enables cost-effective, large-scale synthesis .

  • Stability: Lyophilized formulation retains activity for long-term storage (-80°C) .

Pathophysiological Relevance

US20’s endothelial-specific replication mechanism highlights its role in HCMV dissemination and organ-specific pathology (e.g., vasculitis, congenital infection) . Unlike murine cytomegalovirus M45, US20 does not exhibit anti-apoptotic activity, suggesting distinct evolutionary strategies .

Future Directions

  • Structural Studies: Cryo-EM analysis to resolve 7TMD architecture and ligand-binding sites.

  • Therapeutic Development: US20-targeted interventions to block endothelial infection without affecting fibroblasts.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that is currently in stock. However, if you have any specific requirements for the format, please indicate them in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for the specific delivery timeframe.
All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us and we will prioritize developing the specified tag.
Synonyms
US20; Transmembrane protein HWLF3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Target Names
US20
Target Protein Sequence
MRVISRARSACTWTSCTSLSPCSTSCPPSPAAPTLLRRRSLPQQRRRPSSSPNRRVRGVT TSPCPTRSLVYKRRVGAPQRLCAETVATMQAQEANALLLSRMEALEWFKKFTVWLRVYAI FIFQLAFSFGLGSVFWLGFPQNRNFCVENYSFFLTVLVPIVCMFITYTLGNEHPSNATVL FIYLLANSLTAAIFQMCSESRVLVGSYVMTLALFISFTGLAFLGGRDRRRWKCISCVYVV MLLSFLTLALLSDADWLQKIVVTLCAFSISFFLGILAYDSLMVIFFCPPNQCIRHAVCLY LDSMAIFLTLLLMLSGPRWISLSDGAPLDNGTLTAASTTGKS
Uniprot No.

Target Background

Gene References Into Functions
  1. Inactivation of the Human Cytomegalovirus US20 Gene Hampers Productive Viral Replication in Endothelial Cells. PMID: 26311874
Database Links

KEGG: vg:3077561

Protein Families
Cytomegalovirus US12 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the predicted membrane topology of US20 protein?

The US20 protein is predicted to have seven transmembrane domains (7TMD), as determined by multiple topology prediction algorithms including SOSUI, TopPred 0.01, MEMSAT3, MEMSAT_SVM, and TMHMM 2.0. Experimental investigation confirmed this prediction, establishing that the N-terminus of pUS20 is positioned on the cytosolic side of cellular membranes, while its C-terminus extends into the luminal side. This topology was verified through experimental approaches and is consistent with its localization in endoplasmic reticulum-derived compartments. This specific membrane orientation is important for understanding the protein's function and interactions within infected cells .

Does US20 undergo post-translational modifications?

Yes, US20 undergoes significant post-translational modification through glycosylation. The protein appears as a doublet in immunoblot assays, which results from differential glycosylation. Bioinformatic prediction analyses identified a potential N-glycosylation site at position 242 within the C-terminal tail of the US20 protein. Importantly, among the characterized US12 family members, pUS20 is the first to show post-translational modification through the addition of sugar moieties. When treated with endoglycosidase H (EndoH), the slower-migrating band of the pUS20 doublet exhibited complete sensitivity, indicating that it contains immature, high-mannose N-linked oligosaccharides that have not been processed in the Golgi apparatus. This suggests that pUS20 is retained in the endoplasmic reticulum and does not progress through the secretory pathway .

What is the subcellular localization pattern of US20 protein during infection?

The US20 protein displays a specific subcellular localization pattern during HCMV infection. Immunofluorescence analysis revealed that pUS20 associates with calreticulin-positive compartments throughout the virus replication cycle, indicating its localization to the endoplasmic reticulum (ER). Notably, pUS20 does not significantly associate with cellular and viral markers of the cytoplasmic virus assembly compartment (cVAC), unlike other US12 family members such as US14, US16, US17, and US18. Instead, pUS20 accumulates late in infection in ER-derived peripheral structures localized outside the cVAC. This distinct localization pattern suggests that pUS20 is unlikely to be involved in the final maturation and egress of HCMV virions, but rather functions earlier in the viral life cycle to facilitate replication in endothelial cells .

How does US20 deletion affect viral DNA synthesis in endothelial cells?

Deletion of US20 severely impairs viral DNA synthesis in endothelial cells. Quantitative PCR analysis of human microvascular endothelial cells (HMVECs) infected with US20-deficient viruses showed that viral DNA replication was substantially absent throughout the entire replication cycle compared to wild-type virus. This indicates that the defect in virus replication caused by US20 inactivation occurs prior to the onset of viral DNA synthesis. Since DNA replication is a hallmark of the early phase of the viral life cycle, these findings suggest that US20 functions at a critical juncture between the immediate-early and early phases of infection, specifically in endothelial cells .

What is the impact of US20 deletion on viral gene expression in different cell types?

The impact of US20 deletion on viral gene expression varies dramatically depending on cell type. In human foreskin fibroblasts (HFFs), US20-null viruses exhibit normal accumulation of immediate-early (IE1 and IE2), early (UL44), and late (UL99) viral proteins, indicating that viral gene expression proceeds normally in these cells. In contrast, in endothelial cells (HMVECs), US20 deletion results in approximately 2-fold reduction in immediate-early antigen expression and substantial suppression of early and late gene expression. This cell type-specific effect extends to viral mRNA levels as well, with significant reductions in IE1, UL44, and UL99 transcripts in endothelial cells infected with US20-null viruses. These findings underscore the specialized role of US20 in supporting the progression of viral gene expression specifically in endothelial cells .

How can researchers generate and validate US20 deletion mutants?

Researchers can generate US20 deletion mutants using a two-step replacement strategy with the galK recombineering method. This approach begins with replacing the US20 gene in a bacterial artificial chromosome (BAC) containing the HCMV genome with a galK-kan cassette through homologous recombination in E. coli SW102. The process involves:

  • Amplifying a galK-kan cassette using primers containing homology arms to the US20 gene regions

  • Electroporating this cassette into E. coli SW102 harboring the HCMV BAC

  • Selecting kanamycin and galactose-positive colonies

  • Verifying US20 replacement by PCR and sequencing

  • For counterselection (to generate specific modifications rather than deletions), replacing the galK-kan cassette with a modified US20 gene cassette

Validation of the mutants should include:

  • PCR screening to confirm the absence of US20 or presence of modified variants

  • Restriction enzyme analysis of the BAC DNA

  • DNA sequencing to verify the intended modifications

  • Generation of at least two independent clones to ensure phenotypes don't result from off-target mutations

  • Reconstitution of infectious viruses by transfecting the modified BACs into human fibroblasts

  • Confirming the mutant phenotype through growth curve analyses in different cell types

What methods are effective for analyzing US20 protein expression and localization?

Several complementary methods are effective for analyzing US20 protein expression and localization:

  • Immunoblotting: Using antibodies against epitope tags (such as HA or V5) fused to US20 to detect expression levels and timing during infection. This approach can identify post-translational modifications by revealing mobility shifts in protein bands.

  • Glycosylation analysis: Treatment with endoglycosidase H (EndoH) or peptide-N-glycosidase F (PNGase F) followed by immunoblotting to determine the nature of glycosylation modifications.

  • Immunofluorescence microscopy: Utilizing confocal microscopy with antibodies against epitope-tagged US20 alongside markers for cellular compartments (such as calreticulin for ER) to determine subcellular localization.

  • Co-localization studies: Combining immunofluorescence for US20 with antibodies against other viral proteins or cellular markers to determine spatial relationships during infection.

  • Topology analysis: Using selective permeabilization techniques with digitonin (which permeabilizes only the plasma membrane) versus Triton X-100 (which permeabilizes all cellular membranes) to determine protein orientation within membranes.

These methodologies can be combined to build a comprehensive understanding of US20 expression patterns, post-translational modifications, and subcellular distribution during the course of HCMV infection .

What experimental design is optimal for assessing the impact of US20 on viral replication in different cell types?

An optimal experimental design for assessing US20's impact on viral replication across cell types should include:

  • Viral growth curve analysis:

    • Multistep growth analysis (low MOI of 0.01 PFU/cell) to measure virus spread

    • Single-step growth analysis (high MOI of 3 PFU/cell) to measure replication kinetics

    • Harvesting samples at multiple timepoints post-infection (e.g., 24, 48, 72, 96, 120 hours)

    • Testing in multiple relevant cell types: fibroblasts (HFFs), epithelial cells (ARPE-19), and various endothelial cells (HMVECs, HUVECs, LECs)

  • Molecular analysis of viral replication stages:

    • Viral DNA quantification by qPCR to assess genome replication

    • RT-qPCR to measure viral gene expression at IE, E, and L phases

    • Western blotting to quantify viral protein accumulation (using representatives from each temporal class)

    • Attachment and entry assays using concentrated, partially purified viral particles

  • Controls and validation:

    • Include both wild-type virus and US20 mutant(s)

    • Utilize multiple independently derived mutants

    • Include complementation studies with US20 expression constructs

    • Use appropriate housekeeping genes/proteins as internal controls

  • Statistical analysis:

    • Perform experiments in triplicate

    • Apply appropriate statistical tests to determine significance of differences

    • Present data as means ± standard deviations

This comprehensive approach enables researchers to pinpoint precisely how and where US20 impacts the viral replication cycle in different cellular contexts .

How might the cell type-specific function of US20 relate to HCMV pathogenesis in vivo?

The cell type-specific function of US20 in endothelial cells likely has significant implications for HCMV pathogenesis in vivo. Endothelial cells play crucial roles in viral dissemination throughout the body and in establishing persistent infection. The pronounced defect in viral replication in endothelial cells when US20 is absent suggests this protein may be a key determinant of viral spread and pathogenesis in the host.

Cell TypeEffect of US20 Deletion on Viral ReplicationPotential In Vivo Consequences
Endothelial cells (HMVECs, HUVECs, LECs)Severe replication defectReduced viremia, decreased viral dissemination, limited organ spread
FibroblastsNo significant effectNormal replication in connective tissues
Epithelial cellsNo significant effectNormal replication in epithelial surfaces

Given that HCMV must infect endothelial cells to cross tissue barriers during dissemination, US20's specific role in these cells may represent an adaptation to facilitate spread between different organs. Additionally, endothelial cell infection is implicated in HCMV-associated vascular diseases, including transplant vascular sclerosis and atherosclerosis. Therefore, US20 might be an important virulence factor contributing to these pathological conditions. Future in vivo studies using animal models and clinical isolates with US20 mutations could help elucidate its role in viral pathogenesis, persistence, and the development of HCMV-associated diseases .

What molecular mechanisms might explain US20's cell type-specific effects on viral replication?

Several potential molecular mechanisms could explain US20's cell type-specific effects on viral replication:

  • Cell-specific host factor interactions: US20 may interact with endothelial cell-specific proteins that are essential for proper viral gene expression or genome replication. These interactions might involve signaling pathways, transcription factors, or cellular restriction factors uniquely expressed or regulated in endothelial cells.

  • Regulation of cellular trafficking pathways: Given its ER localization, US20 might modulate trafficking of cellular or viral proteins in ways that are critical specifically in endothelial cells. This could involve regulating components of the secretory pathway or affecting antigen presentation.

  • Cell type-specific immune evasion: Endothelial cells may have unique innate immune sensing mechanisms that US20 helps counteract. The protein might interfere with pattern recognition receptors or signaling cascades that would otherwise inhibit viral replication.

  • Modulation of cell type-specific transcription factors: The most pronounced defect in US20-null viruses occurs at the transition from immediate-early to early gene expression, suggesting US20 might facilitate the function of transcription factors needed for this transition specifically in endothelial cells.

  • Regulation of endothelial-specific metabolic pathways: US20 could modulate metabolic processes unique to endothelial cells that support optimal viral replication.

Experimental approaches to investigate these mechanisms could include proteomics to identify US20-interacting proteins in different cell types, transcriptomics to determine cell type-specific effects on host gene expression, and targeted studies of relevant signaling pathways .

How does the membrane topology and glycosylation of US20 contribute to its function?

The membrane topology and glycosylation of US20 likely play crucial roles in determining its functional capabilities:

  • Seven transmembrane domain structure: The 7TMD organization places US20 in a select group of viral proteins with this topology. This structure could facilitate:

    • Formation of a channel or pore in cellular membranes

    • Creation of a scaffold for protein-protein interactions

    • Sensing of membrane composition or curvature

    • Modulation of cellular signaling pathways

  • N-terminal cytosolic orientation: With its N-terminus in the cytosol, US20 can potentially:

    • Interact with cytoplasmic signaling molecules

    • Engage with components of the viral replication machinery

    • Modulate cytoskeletal elements that might differ between cell types

  • C-terminal luminal orientation and glycosylation: The C-terminus extending into the ER lumen and undergoing glycosylation may:

    • Stabilize the protein structure

    • Facilitate interactions with luminal chaperones or other proteins

    • Protect from degradation

    • Modulate protein folding

  • ER retention without progression to Golgi: This localization pattern suggests US20 functions within the ER rather than at the cell surface or other compartments, potentially:

    • Affecting ER stress responses that might be differentially regulated in endothelial cells

    • Modulating calcium signaling from the ER

    • Influencing protein quality control pathways

Research to elucidate these functions could include site-directed mutagenesis of the glycosylation site, generation of chimeric proteins with other 7TMD family members, and detailed analysis of protein-protein interactions in the context of different cellular compartments .

What is the evolutionary significance of the US12 gene family diversity and conservation?

The evolutionary significance of the US12 gene family, including US20, reflects sophisticated viral adaptation to diverse host cell environments:

  • Functional diversification: The US12 family encompasses 10 genes (US12-US21) that encode 7TMD proteins with distinct functions. For example, while US20 is critical for replication in endothelial cells, US16 affects growth in both endothelial and epithelial cells, and US18 influences replication in gingival tissue. This diversification likely represents evolutionary adaptation to optimize viral fitness across different host tissues.

  • Selective pressure patterns: The retention of this gene family despite their non-essential nature in fibroblasts suggests strong selective pressure for their maintenance during HCMV evolution. The cell type-specific functions point to adaptation for in vivo replication and spread, rather than simple growth in laboratory conditions.

  • Host-pathogen co-evolution: The specialized functions of US12 family members may reflect ongoing evolutionary arms races with host defense mechanisms. Each gene might have evolved to counter specific aspects of intrinsic or innate immunity that differ between cell types.

  • Contribution to viral cell tropism: The collective action of the US12 family members appears central to HCMV's broad cell tropism. Their varied functions in different cell types likely enable the virus to replicate efficiently across diverse tissues, contributing to HCMV's success as a widespread human pathogen.

  • Potential redundancy mechanisms: While individual US12 family members show specific phenotypes when deleted, some functional overlap or redundancy may exist. This could explain why certain phenotypes are modest in magnitude or cell type-restricted.

Comparative genomics across clinical HCMV isolates and related cytomegaloviruses from other species could further illuminate the evolutionary history and significance of this gene family .

What therapeutic implications might arise from understanding US20 function?

Understanding US20 function offers several promising therapeutic implications:

  • Novel antiviral targets: The cell type-specific requirement for US20 in endothelial cell infection presents an opportunity for developing antivirals that could selectively target viral dissemination without affecting all aspects of viral replication. This might lead to drugs with improved efficacy and safety profiles compared to current options.

  • Attenuated vaccine development: Manipulation of US20 could potentially generate attenuated HCMV strains that replicate poorly in endothelial cells, limiting dissemination while maintaining immunogenicity in other cell types. Such strains could serve as live attenuated vaccine candidates with favorable safety profiles.

  • Prevention of HCMV-associated vascular diseases: Given US20's importance in endothelial cell infection, therapeutics targeting this protein might specifically reduce the vascular complications associated with HCMV, such as transplant vascular sclerosis, restenosis, or atherosclerosis.

  • Diagnostic applications: Knowledge of US20 function could inform the development of diagnostic tools to better predict HCMV virulence or tissue tropism in clinical isolates.

  • Vector development for gene therapy: Understanding US20's cell type-specific effects could aid in designing HCMV-based vectors for targeted gene delivery to specific tissues while avoiding unwanted spread.

  • Insights for broad-spectrum antivirals: Comparing the mechanisms of US20 with other viral proteins that facilitate cell type-specific replication might reveal conserved strategies that could be targeted by broad-spectrum antivirals.

Research toward these applications would require detailed structural studies of US20, identification of its interaction partners, and development of small molecule inhibitors or peptide mimetics that could disrupt its function .

What are common challenges in working with transmembrane viral proteins like US20?

Researchers studying transmembrane viral proteins like US20 frequently encounter several technical challenges:

  • Protein expression and purification: The hydrophobic nature of 7TMD proteins makes them difficult to express in heterologous systems and challenging to purify in their native conformation. Specialized detergents, membrane mimetics, or expression systems may be necessary.

  • Structural analysis limitations: Traditional structural biology techniques like X-ray crystallography are challenging to apply to transmembrane proteins. Newer approaches like cryo-electron microscopy may be more suitable but still technically demanding.

  • Antibody generation: Developing specific antibodies against transmembrane proteins is difficult due to their limited exposed epitopes and the challenges in using them as immunogens while maintaining their native structure.

  • Functional assays: Assessing function often requires maintaining the protein in a membrane environment, complicating biochemical and biophysical analyses.

  • Protein-protein interaction studies: Traditional methods like co-immunoprecipitation may disrupt important interactions due to the detergents required to solubilize membrane proteins.

Researchers can address these challenges by:

  • Using epitope tags (as demonstrated with HA and V5 tags for US20)

  • Employing specialized membrane protein expression systems

  • Utilizing native immunoprecipitation protocols with mild detergents

  • Applying proximity labeling approaches for interaction studies

  • Conducting functional studies in intact cells rather than with purified components

What controls are essential when studying US20 mutants in different cell types?

When studying US20 mutants across different cell types, several essential controls should be implemented:

  • Multiple independent mutants: Generate and test at least two independently derived US20 mutants to ensure observed phenotypes don't result from off-target mutations or recombination events.

  • Revertant viruses: Create revertant viruses where the wild-type US20 sequence is restored to confirm that phenotypes are specifically due to US20 rather than other genomic changes.

  • Trans-complementation: Express US20 in trans from expression vectors in cells infected with US20-null viruses to determine if the defect can be rescued.

  • Cell viability assessment: Monitor cell viability throughout experiments to ensure differences in viral replication aren't due to differential cytotoxic effects between cell types.

  • Infection efficiency controls: Quantify the initial infection rates (e.g., by measuring IE1 expression at very early timepoints) to ensure differences in replication aren't simply due to differences in initial infection efficiency.

  • Multiple cell lines of each type: Test effects in multiple independently derived cell lines of each type (e.g., different sources of endothelial cells) to ensure findings aren't specific to individual cell lines.

  • Temporal controls: Analyze multiple timepoints to distinguish between true defects and merely delayed replication kinetics.

  • Positive controls: Include mutations in other viral genes with known phenotypes to validate experimental systems.

How can researchers optimize the detection and functional analysis of glycosylated viral proteins?

Researchers can optimize detection and functional analysis of glycosylated viral proteins like US20 through several specialized approaches:

  • Glycosylation site prediction and validation:

    • Use multiple bioinformatic tools (e.g., NetGlyc) to predict potential N-linked and O-linked glycosylation sites

    • Confirm predictions through site-directed mutagenesis of predicted glycosylation sites (e.g., changing asparagine to glutamine in N-X-S/T motifs)

    • Compare migration patterns of wild-type and mutant proteins by SDS-PAGE

  • Glycosidase treatments:

    • Use multiple glycosidases with different specificities:

      • Endoglycosidase H (EndoH): Cleaves high-mannose and some hybrid N-linked oligosaccharides, but not complex N-linked glycans

      • PNGase F: Removes almost all types of N-linked glycans

      • O-glycosidases: Remove O-linked glycans

    • Include appropriate controls (known glycoproteins) to confirm enzyme activity

  • Specialized detection methods:

    • Use lectins (carbohydrate-binding proteins) conjugated to fluorophores or enzymes to detect specific glycan structures

    • Apply glycan-specific antibodies for certain sugar modifications

    • Employ metabolic labeling with sugar analogs that can be tagged via click chemistry

  • Functional analysis of glycosylation:

    • Generate glycosylation site mutants and assess their:

      • Expression levels and stability

      • Subcellular localization (using confocal microscopy)

      • Ability to complement the defects of US20-null viruses

    • Use inhibitors of specific glycosylation pathways (such as tunicamycin for N-linked glycosylation) to assess functional importance

  • Mass spectrometry approaches:

    • Use glycoproteomics to characterize specific glycan structures at individual sites

    • Apply specialized enrichment strategies for glycopeptides prior to analysis

These optimized methods can provide detailed insights into how glycosylation contributes to US20's stability, localization, and function in different cellular contexts .

How does US20 function compare with other members of the US12 gene family?

A comparative analysis of US20 with other US12 family members reveals both shared properties and distinct functional characteristics:

US12 Family MemberSubcellular LocalizationCell Type-Specific EffectsKnown Functions
US20ER-derived structures outside cVACCritical for replication in endothelial cellsRequired for transition from IE to E phase
US16Associates with cVACEssential for growth in endothelial and epithelial cellsUnknown precise mechanism
US18Associates with cVACRequired for replication in human gingival tissueUnknown precise mechanism
US14Associates with cVACUnknownUnknown
US17Associates with cVACUnknownUnknown

Key comparative observations:

  • Localization differences: Unlike US14, US16, US17, and US18, which associate with the cytoplasmic viral assembly compartment (cVAC), US20 localizes to ER-derived peripheral structures outside the cVAC. This distinct localization pattern suggests US20 functions at a different stage of the viral life cycle compared to its family members.

  • Cell tropism effects: While US20 specifically affects replication in endothelial cells, US16 impacts growth in both endothelial and epithelial cells, and US18 influences replication in gingival tissue. This indicates that different US12 family members have evolved specialized roles in determining HCMV's broad cell tropism.

  • Glycosylation status: Among characterized US12 family members, US20 is the first shown to undergo glycosylation, suggesting unique post-translational regulation compared to other family members.

  • Replication cycle stage: US20 functions at the transition from immediate-early to early gene expression, whereas the precise stage at which other family members act remains less defined.

These comparative differences highlight the functional diversification within the US12 gene family, with individual members likely evolving to optimize viral replication in specific cellular environments through distinct mechanisms .

What insights can be gained from studying US20 homologs in animal cytomegaloviruses?

Studying US20 homologs in animal cytomegaloviruses can provide valuable insights into evolutionary conservation, functional significance, and in vivo relevance:

  • Evolutionary conservation: While direct homologs of US20 may not be readily identifiable in all animal cytomegaloviruses due to sequence divergence, functional homologs that serve similar roles in endothelial cell infection might exist. Identifying these would illuminate evolutionary conservation of this function across cytomegalovirus species.

  • Animal model development: Understanding US20 homologs in animal models such as mouse, guinea pig, or rhesus macaque cytomegaloviruses could enable the development of more relevant models for studying HCMV pathogenesis. For instance, if a murine cytomegalovirus (MCMV) protein has similar functions to US20, this could facilitate in vivo studies using genetically modified viruses.

  • Functional diversity: Comparing how different cytomegalovirus species have evolved strategies for infecting endothelial cells might reveal multiple mechanisms that achieve similar outcomes. For example, while HCMV uses US20, MCMV employs M45 to mediate replication in endothelial cells (though through a different mechanism involving apoptosis inhibition).

  • Host adaptation signatures: Analyzing sequence variations in US20 homologs across cytomegalovirus species that infect different hosts could reveal adaptation signatures that match specific host factors or restriction mechanisms.

  • Cross-species conservation of critical domains: Identifying highly conserved domains across species might highlight functionally critical regions that could serve as targets for broad-spectrum antivirals.

This comparative approach across species could both enhance fundamental understanding of viral evolution and facilitate translational research by improving animal models and identifying conserved therapeutic targets .

How might the study of US20 inform our understanding of other viral 7TMD proteins?

The study of US20 provides several important insights that could inform our understanding of other viral 7TMD proteins:

  • Structural and functional paradigms: US20's seven-transmembrane topology with N-terminus in the cytosol and C-terminus in the lumen establishes a structural paradigm that may apply to other viral 7TMD proteins. This topology creates distinct functional domains that can interact with different cellular compartments.

  • Cell type-specific functions: US20's selective importance in endothelial cells demonstrates how viral 7TMD proteins can evolve highly specialized functions that are crucial in specific cellular environments but dispensable in others. This principle may apply to 7TMD proteins from other viruses.

  • Post-translational modifications: The glycosylation of US20 highlights how post-translational modifications can regulate viral 7TMD proteins. Similar modifications might be important for other viral 7TMD proteins but may have been overlooked.

  • Subcellular targeting: US20's specific localization to ER-derived structures illustrates how viral 7TMD proteins can target particular subcellular compartments to execute their functions, rather than trafficking to the plasma membrane like many cellular 7TMD receptors.

  • Interaction with cellular machinery: The ability of US20 to facilitate progression from immediate-early to early gene expression specifically in endothelial cells suggests it interacts with cellular machinery in a cell type-dependent manner. This concept may apply broadly to other viral 7TMD proteins.

  • Evolution from cellular precursors: The predicted similarity of US20 to members of the TMBIM family (though without their anti-apoptotic function) suggests viral 7TMD proteins may have evolved from captured cellular genes but diverged functionally. Similar evolutionary histories might explain other viral 7TMD proteins.

These insights from US20 provide a framework for investigating the diverse functions of 7TMD proteins encoded by other viruses, potentially revealing common mechanisms and evolutionary patterns .

What genomic approaches could reveal the mechanism of US20's cell type-specific effects?

Several genomic approaches could help uncover the mechanism behind US20's cell type-specific effects:

  • Comparative transcriptomics: RNA-seq analysis comparing endothelial cells, fibroblasts, and epithelial cells infected with wild-type versus US20-null viruses could reveal:

    • Cell type-specific gene expression patterns affected by US20

    • Pathways differentially regulated in the presence/absence of US20

    • Temporal changes in host transcriptome that correlate with the block in viral replication

  • ATAC-seq or similar chromatin accessibility assays: These could identify differences in chromatin state in different cell types during infection, potentially revealing:

    • Cell type-specific chromatin landscape changes dependent on US20

    • Accessibility of viral promoters in different cell backgrounds

    • Host chromatin regions differentially regulated by US20

  • ChIP-seq for relevant transcription factors: Chromatin immunoprecipitation followed by sequencing for viral (IE2) and cellular transcription factors in the presence/absence of US20 could identify:

    • Differential binding patterns at early viral promoters

    • Cell type-specific transcription factor recruitment affected by US20

    • Potential direct or indirect effects of US20 on transcription factor activity

  • Ribosome profiling: This approach could determine if US20 affects translation of viral or cellular mRNAs in a cell type-specific manner.

  • CRISPR screens: Genome-wide or targeted CRISPR screens in endothelial cells could identify host factors that:

    • Rescue US20-null virus replication when knocked out

    • Are required for US20 function

    • Show synthetic lethality with US20 deletion

  • Single-cell RNA-seq: This could reveal heterogeneity in cellular responses to infection and identify specific cell subpopulations where US20 is particularly important.

These genomic approaches, especially when applied in combination, could provide comprehensive insights into the molecular basis of US20's cell type-specific function .

What structural biology approaches would be most informative for understanding US20 function?

Several structural biology approaches would be particularly informative for understanding US20 function:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized the structural analysis of membrane proteins and could:

    • Determine the three-dimensional structure of US20 in a lipid environment

    • Reveal how the seven transmembrane domains are arranged

    • Identify potential ligand-binding pockets or interaction surfaces

    • Visualize US20 in complex with binding partners

  • Nuclear magnetic resonance (NMR) spectroscopy: This could provide:

    • Dynamic information about flexible regions of US20

    • Details about conformational changes upon ligand binding

    • Information about specific amino acid interactions within the protein

  • X-ray crystallography: Though challenging for membrane proteins, this might be applicable to:

    • Soluble domains of US20

    • US20 in complex with antibody fragments

    • US20 stabilized by fusion to crystallization chaperones

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach could:

    • Map exposed regions of US20

    • Identify conformational changes upon binding to interaction partners

    • Provide information about protein dynamics in different membrane environments

  • Cross-linking mass spectrometry (XL-MS): This technique could:

    • Identify intramolecular contacts within US20

    • Map interaction interfaces with binding partners

    • Provide distance constraints to inform computational modeling

  • Molecular dynamics simulations: Based on experimental structural data, simulations could reveal:

    • How US20 interacts with membrane lipids

    • Potential conformational changes during function

    • Effects of glycosylation on protein structure and dynamics

  • Single-particle tracking and super-resolution microscopy: These approaches could:

    • Visualize US20 dynamics in living cells

    • Track its movement and clustering during infection

    • Detect co-localization with cellular factors at nanoscale resolution

These structural approaches would provide critical insights into how US20's structure enables its cell type-specific functions and could inform the development of targeted therapeutics .

What are the most promising directions for translating US20 research into clinical applications?

The most promising directions for translating US20 research into clinical applications include:

  • Development of US20-targeted antivirals:

    • Small molecule inhibitors that disrupt US20 function could selectively block HCMV replication in endothelial cells

    • Peptide-based inhibitors mimicking critical interaction domains could prevent US20 from engaging with cellular partners

    • Such antivirals might particularly benefit patients at risk for HCMV-associated vascular diseases

  • Attenuated vaccine development:

    • US20-modified HCMV strains could serve as live attenuated vaccine candidates

    • These viruses would replicate in some cell types (maintaining immunogenicity) while showing limited dissemination due to endothelial cell tropism defects

    • Precise modifications could be designed based on structural and functional understanding

  • Diagnostic applications:

    • Genetic analysis of US20 sequences in clinical HCMV isolates might predict virulence or tissue tropism

    • Such diagnostics could help stratify patients by risk and guide preemptive therapy decisions

    • Monitoring US20 polymorphisms could track viral evolution during long-term infection

  • Gene therapy vector development:

    • Knowledge of US20's role in cell tropism could be exploited to engineer HCMV-based vectors with tailored tissue specificity

    • These vectors could deliver therapeutic genes to specific cell types while avoiding others

  • Prevention of transplant-associated HCMV disease:

    • Given US20's importance in endothelial infection, targeting it might specifically reduce the vascular complications following solid organ or hematopoietic stem cell transplantation

    • This approach could complement existing antiviral strategies by focusing on preventing specific pathogenic outcomes

  • Biomarkers for HCMV vascular pathogenesis:

    • Understanding US20's interactions with endothelial cells might reveal biomarkers that predict or detect HCMV-associated vascular pathology

    • Such biomarkers could guide therapeutic decision-making in at-risk populations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.