Recombinant Human cytomegalovirus Transmembrane protein HWLF4 (US19)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. To prioritize a specific tag, please indicate your preference during order placement.
Synonyms
US19; Transmembrane protein HWLF4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-240
Protein Length
full length protein
Species
Human cytomegalovirus (strain Towne) (HHV-5) (Human herpesvirus 5)
Target Names
US19
Target Protein Sequence
MLHVVPLEWTVEEVVPYLERLAVWLRASVLVAFQLTATVALSVLSWWLMPPPVAELCERG RDDDPPPLSHLSLVVPVGCLFLLLRGPSIDRCPRKLPLLLAYCLPHALAFLTLLMCQPSP QAFVGAALLALAVDLSCLGASLLGCDPGASLRRLWLPSVLSLLCATALGLWLLRAAAPFF LGLHATTLLTVTLMLIHDLSLITCQSSFPESFQPSLRLYVENVALFIGMYHLLRLWLWSP
Uniprot No.

Target Background

Protein Families
Cytomegalovirus US12 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the general structure and function of HCMV US19 protein?

US19 is a transmembrane protein encoded within the unique short (US) region of the HCMV genome. While specific structural data remains limited, analysis suggests it contains hydrophobic domains characteristic of transmembrane viral proteins. Functionally, US19 appears to participate in viral assembly pathways similar to other HCMV transmembrane components. The protein likely contributes to membrane reorganization during viral morphogenesis, though further structural analysis using techniques applied to other viral proteins is needed .

What expression systems are most effective for recombinant US19 protein production?

For expression of HCMV transmembrane proteins including US19, mammalian expression systems generally yield better results than bacterial systems due to appropriate post-translational modifications. MRC-5 cells have demonstrated particular efficacy for HCMV protein expression, as evidenced in studies with other HCMV components. For optimal expression, viral DNA transfection into characterized MRC-5 cell banks followed by amplification through infection cycles provides consistent protein production. Collection from supernatants rather than cell lysates may yield better quality preparations for transmembrane proteins .

How can researchers confirm proper folding and expression of recombinant US19 protein?

Verification requires a multi-faceted approach:

Verification MethodApplication to US19Key Parameters
Western blottingPrimary detectionAnti-US19 antibodies or epitope tag detection
ImmunofluorescenceLocalization analysisCellular distribution pattern
Glycosylation analysisPost-translational modificationPNGase F treatment comparison
Functional assaysActivity confirmationMembrane integration verification

Confirming protein expression should involve both quantitative (Western blot) and qualitative (localization) approaches to ensure the recombinant protein maintains native characteristics .

How can analog-sensitive approaches be applied to study US19 function?

Based on successful implementation with viral kinase pUL97, an analog-sensitive approach could be valuable for US19 study. This would involve:

  • Identifying key functional residues in US19 through sequence alignment

  • Creating point mutations to render the protein sensitive to specific inhibitors

  • Introducing the mutant version into the HCMV genome using BAC technology

  • Testing protein function with and without inhibitor treatment

This methodology allows for temporal control of protein function during the viral life cycle. The mutant virus should replicate normally in the absence of inhibitor while displaying conditional defects when the inhibitor is present, enabling precise analysis of US19's role at different stages of infection .

What are the key considerations when designing neutralization assays involving US19?

Effective neutralization assays for US19-focused studies should consider:

  • Cell line selection: ARPE-19 or MRC-5 cells have proven effective for HCMV neutralization studies

  • Reporter systems: GFP-tagged HCMV strains facilitate quantitative analysis

  • Serum dilution protocols: Initial 1:4 dilution followed by 2-fold serial dilutions

  • Incubation parameters: 1 hour at 37°C for virus-serum interaction

  • Readout methods: Both fluorescence microscopy (4-5 days post-infection) and quantitative measurement of relative fluorescent units (7 days post-infection)

Data analysis should include plotting mean RLUs versus log[serum dilution⁻¹] with best-fit 4-parameter curves to determine neutralizing titers .

How can researchers develop chimeric systems to study US19 function in different HCMV strain backgrounds?

Creating chimeric systems for US19 functional analysis requires:

  • Selection of appropriate parental strains (e.g., Towne and Toledo strains)

  • Preparation of overlapping cosmid clones spanning the entire HCMV genome

  • Strategic replacement of cosmids containing the US19 region

  • Cotransfection of selected cosmids for virus regeneration

  • Verification of chimeric virus genome structure through restriction mapping and sequencing

This approach is particularly valuable for comparing US19 function between laboratory-adapted strains (like Towne) and clinical isolates (like Toledo). When designing chimeras, researchers should consider maintaining the genomic context around US19 to preserve authentic regulation patterns .

What methodological approaches should be used to identify US19 interacting partners?

Identification of US19 interaction partners requires complementary approaches:

MethodApplicationAdvantage
IP-MSMass identification of interacting proteinsComprehensive discovery approach
Yeast two-hybridDirect protein-protein interactionsDetection of binary interactions
FRET/BRETIn vivo interaction dynamicsReal-time analysis in living cells
BiFCVisualization of interactionsSpatial localization in cellular context
Crosslinking proteomicsTransient interactionsCaptures weak/dynamic interactions

For transmembrane proteins like US19, proximity labeling methods (BioID or APEX) offer particular advantages by identifying nearby proteins in the membrane environment. Sample preparation should preserve membrane integrity through appropriate detergent selection .

How can mutations in US19 be analyzed for impact on viral replication and pathogenesis?

A comprehensive US19 mutational analysis should include:

  • Systematic mutation design targeting conserved domains and predicted functional motifs

  • Generation of recombinant viruses carrying specific US19 mutations using BAC technology

  • Replication analysis through monitoring:

    • Intracellular viral DNA accumulation (qPCR)

    • Extracellular viral DNA release

    • Production of infectious viral progeny

Data collection at multiple timepoints (6 hours, 1, 3, 6, and 8 days post-infection) allows for detailed replication kinetics assessment. Comparison to wild-type virus provides a baseline for identifying replication defects. For transmembrane proteins, particular attention should be paid to virion assembly and release stages .

What are the best approaches for troubleshooting expression problems with recombinant US19?

When encountering expression difficulties with recombinant US19:

  • Optimize codon usage for the expression system

  • Test multiple cell lines (MRC-5, ARPE-19, HFF) for optimal expression

  • Evaluate different promoter strengths to balance expression levels

  • Consider fusion tags that enhance stability while minimizing functional interference

  • Test various detergents for membrane protein solubilization

  • Implement temperature modulation during expression

  • Assess glycosylation status and impact on protein stability

For particularly challenging constructs, consider an inducible expression system that allows tight regulation of potentially toxic protein levels .

How can researchers distinguish between direct and indirect effects of US19 mutations?

Distinguishing direct from indirect effects requires complementary approaches:

  • Temporal control systems: Analog-sensitive mutations allow inhibition at specific timepoints

  • Complementation assays: Expression of wild-type US19 in trans to rescue mutant phenotypes

  • Domain-specific mutations: Targeting specific functional domains rather than deletion mutants

  • Quantitative proteomics: Monitoring changes in viral and cellular protein levels

  • Interaction verification: Confirming disruption of specific interactions rather than global effects

The key is establishing a direct causative link between the US19 mutation and observed phenotypes through multiple lines of evidence .

What bioinformatic approaches can predict functional domains within US19?

Computational analysis of US19 should integrate:

  • Multiple sequence alignment across cytomegalovirus species to identify conserved residues

  • Transmembrane domain prediction (TMHMM, Phobius)

  • Secondary structure prediction (PSIPRED, JPred)

  • Post-translational modification site prediction (NetPhos, NetOGlyc)

  • Protein-protein interaction motif identification

  • Disorder prediction to identify flexible regions

  • Homology modeling against structurally characterized viral membrane proteins

Integration of these predictions with experimental data creates a comprehensive functional map of US19 domains. Particular attention should be paid to regions showing evolutionary conservation, suggesting functional importance .

How can cryo-EM approaches be optimized for structural studies of US19?

Cryo-EM optimization for US19 structural studies should address:

  • Sample preparation challenges for transmembrane proteins

  • Detergent selection versus nanodiscs or amphipols for membrane mimetics

  • Particle orientation bias common with membrane proteins

  • Data collection parameters for optimal resolution

  • Processing workflows for heterogeneous samples

Recent advances in cryo-EM have enabled determination of membrane protein structures at near-atomic resolution. For US19, focusing on stable protein-detergent complexes or reconstitution into nanodiscs may provide the most promising approach .

How can integrative structural biology approaches enhance understanding of US19 function?

An integrative structural approach to US19 would combine:

This multi-technique approach provides complementary structural information that no single method can deliver. For transmembrane viral proteins like US19, combining these approaches overcomes limitations inherent to each individual method .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.