Recombinant Human cytomegalovirus Transmembrane protein US19 (US19)

Shipped with Ice Packs
In Stock

Description

Introduction to US19

The Recombinant Human cytomegalovirus Transmembrane protein US19 (US19) is a viral glycoprotein encoded by the US19 gene in the human cytomegalovirus (HCMV) genome. While HCMV’s US gene family (US1–US16) has been extensively studied for immune evasion and viral persistence, US19 remains poorly characterized in existing literature. This article synthesizes available data on US19’s structure, function, and potential roles, highlighting gaps in current research.

Gene Location and Transcription

  • Genomic Context: The US19 gene is located in the unique short (US) region of the HCMV genome, flanked by internal repeats (IRL/IRS).

  • Transcription: US19 is part of the HCMV late gene expression profile, with transcription occurring during the viral lytic cycle.

Protein Characteristics

  • Transmembrane Domain: US19 is predicted to contain a transmembrane domain, suggesting localization to cellular membranes (e.g., ER, Golgi, or plasma membrane).

  • Post-Translational Modifications: Potential glycosylation sites (though not experimentally confirmed) may influence protein stability or interactions.

Comparative Analysis with Other US Proteins

FeatureUS19US9 (Reference)
Subcellular LocalizationPredicted membrane-associatedER, mitochondria, and cytosolic foci
Immune EvasionHypothetical (unstudied)Inhibits MAVS/STING pathways
Viral ReplicationUnknownAffects plaque size in retinal cells

Potential Functions

  • Immune Modulation: Like US9, US19 may interfere with host antiviral pathways (e.g., IRF3/STING signaling), though no direct evidence exists.

  • Viral Entry/Cell Spread: Transmembrane proteins often mediate viral entry or cell-to-cell transmission, but US19’s role remains unexplored.

Challenges in Studying US19

  • Lack of Recombinant Studies: No recombinant US19 constructs or knockout mutants have been reported in the literature.

  • Expression Patterns: Limited data on temporal/spatial expression during HCMV infection.

Recombinant Protein Production

  • System: Mammalian or insect cell systems (e.g., HEK293T or Sf9 cells) for proper post-translational modifications.

  • Applications:

    • Antigenic Profiling: Assess immunogenicity for vaccine development.

    • Interaction Mapping: Identify host protein partners via co-IP/MS.

Functional Validation

  • Knockout Mutants: Generate HCMVΔUS19 to study replication defects or altered pathogenesis.

  • In Vitro Assays:

    • IFN-β Inhibition: Test US19’s impact on innate immune signaling.

    • Cell Fusion/Entry: Evaluate role in viral spread.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
US19; Transmembrane protein US19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-240
Protein Length
full length protein
Species
Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)
Target Names
US19
Target Protein Sequence
MLHVVPLEWTVEEVVPYLERLAVWLRASVLVAFQLTATVALSVLSWWLMPPPVAELCERG RDDDPPSLSHLSLVVPVGCLFLLLRGPSIDRCPRKLPLLLAYCLPHALAFLTLLMCQPSP QAFVGAALLALAVDLSCLGASLLGCDPGASLRRLWLPSVLSLLCATALGLWLLRAAAPFF LGLHATTLLTVTLMLIHDLSLITCQSSFPESFQPSLRLYVENVALFIGMYHLLRLWLWSP
Uniprot No.

Target Background

Database Links

KEGG: vg:3077522

Protein Families
Cytomegalovirus US12 family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is Human Cytomegalovirus US19 and what is its significance in viral biology?

Human Cytomegalovirus US19 is a transmembrane protein encoded by the HCMV unique short (US) region. Like other viral transmembrane proteins, US19 is likely involved in modifying host cell functions during viral infection. While specific information on US19 is limited in the provided search results, HCMV is known to extensively modulate host cells, downregulating over 900 human proteins during viral replication and degrading at least 133 proteins shortly after infection .

The methodological approach to understanding US19 function would mirror those used for other HCMV proteins, such as the interactome analysis performed by researchers to map virus-host protein interactions. Such analyses have identified networks of over 3400 virus-host and over 150 virus-virus protein interactions, providing insights into functions for multiple viral genes .

How are recombinant HCMV proteins typically generated for research purposes?

Recombinant HCMV proteins for research are typically generated using several approaches:

  • Stable expression in human cell lines: Similar to the approach used in interactome studies where researchers created tagged, stably-expressed canonical strain Merlin HCMV proteins in infected cells .

  • Cosmid clone systems: As demonstrated in vaccine development research, overlapping cosmid clones can be prepared from genomic DNA of HCMV strains. For example, in the Towne/Toledo chimera vaccines study, 8 cosmids were selected that spanned the entire HCMV genome and could regenerate infectious virus after cotransfection .

  • Recombineering techniques: The BAC (Bacterial Artificial Chromosome) system has been employed for generating recombinant viruses. For instance, HCMV expressing rGFP from a P2A self-cleaving peptide at the 3'-end of coding regions has been generated by recombineering the strain Merlin BAC .

What expression systems are most effective for producing functional HCMV transmembrane proteins?

For transmembrane proteins like US19, the following expression systems have proven effective:

Expression SystemAdvantagesLimitationsBest For
Mammalian Cell Lines (e.g., MRC-5, ARPE-19)Proper folding, authentic post-translational modificationsHigher cost, lower yieldFunctional studies requiring native conformation
Insect Cells (Baculovirus)Higher yield than mammalian cells, eukaryotic processingSome differences in glycosylation patternsStructural studies requiring higher protein amounts
Cell-Free SystemsRapid production, avoids cell toxicityLimited post-translational modificationsInitial screening, peptide production

MRC-5 cells are commonly used for HCMV research, as evidenced by their use in virus stock preparation and transfection experiments in published studies . For solubilization of multi-pass transmembrane proteins, detergents such as 1% w/v digitonin in TBS have been successfully employed .

What are the optimal purification strategies for HCMV transmembrane proteins?

Purification of transmembrane viral proteins like US19 requires specialized approaches:

  • Detergent selection: Research has shown that different transmembrane proteins require specific detergents for optimal solubilization. For HCMV studies, researchers have used different lysis buffers based on protein characteristics. For soluble and single-pass transmembrane proteins, a buffer containing 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 0.5% v/v NP40, 1 mM DTT and protease inhibitor cocktail has been effective. For proteins with two or more transmembrane domains (likely including US19), 1% w/v digitonin in TBS with protease inhibitor cocktail has proven successful .

  • Affinity purification: V5-tagged viral proteins have been successfully purified using immobilized mouse monoclonal anti-V5 agarose resin, with incubation times of approximately 3 hours .

  • Quality control: Transmembrane predictions can be derived from Uniprot for canonical HCMV proteins, or generated using TMHMM for novel proteins .

What techniques are most effective for studying HCMV US19 protein interactions?

Based on successful approaches with other HCMV proteins, the following techniques would be effective for studying US19 interactions:

  • Mass spectrometry-based interactome analysis: This approach was used to identify over 3400 virus-host protein interactions for 169 HCMV proteins . The methodology involves expression of tagged proteins, immunoprecipitation, and mass spectrometry analysis.

  • Co-immunoprecipitation validation: Following identification of potential interactions, validation can be performed using co-immunoprecipitation experiments, as demonstrated with ORFL147C protein interactions with splicing regulators MBNL1 and CELF1 .

  • Domain analysis: Computational prediction of binding domains can guide interaction studies. For example, domain analysis predicted binding of the viral UL25 protein to SH3 domains of NCK Adaptor Protein-1 .

How can researchers assess the impact of US19 on HCMV replication and pathogenesis?

To assess the functional importance of viral proteins like US19, researchers typically use the following approaches:

  • Generation of mutant viruses: Recombineering techniques can be used to create viral mutants with specific modifications to the protein of interest. For example, researchers generated an ORFL147C mutant by introducing substitutions into three in-frame ATG codons at the 5'-end of the gene without affecting overlapping genes .

  • Growth curve analysis: Comparing the growth kinetics of mutant versus wild-type virus can reveal the functional importance of a protein. Significantly impaired growth of the ΔORFL147C virus suggested an important functional role during viral infection .

  • Whole-genome sequencing: Consensus sequences of recombinant viruses can be derived using next-generation sequencing platforms like Illumina to confirm genetic modifications and ensure no additional mutations are present .

What immune evasion functions have been attributed to HCMV transmembrane proteins similar to US19?

HCMV encodes numerous proteins involved in immune evasion, and transmembrane proteins often play critical roles in this process:

  • Fc receptor-like functions: HCMV encodes viral Fc-gamma receptors (vFcγRs) that counteract antibody-mediated activation in vitro. These proteins can prolong lytic replication during primary infection by evading virus-specific adaptive immune responses, particularly antibodies .

  • Disruption of antigen presentation: HCMV transmembrane proteins can interfere with MHC class I and II presentation pathways, allowing infected cells to evade T cell recognition.

  • Modulation of cellular receptors: Some HCMV proteins modify or downregulate host cell surface proteins involved in immune recognition.

When studying US19, researchers should consider these potential mechanisms and design experiments to test for similar functions.

How do mutations in US19 affect epithelial and endothelial cell tropism of HCMV?

Cell tropism in HCMV is significantly influenced by viral proteins, particularly those forming complexes required for cell entry. While specific information on US19's role in tropism isn't available in the search results, the methodology for investigating such functions can be derived from studies of other HCMV proteins:

  • Pentameric complex analysis: The HCMV pentameric complex (comprising gH, gL, UL128, UL130, and UL131A) is crucial for epithelial/endothelial cell tropism. Mutations in these components can alter viral tropism. For example, the Towne vaccine strain has a mutation in UL130 that disrupts the pentameric complex and consequently lacks epithelial/endothelial cell tropism .

  • In vitro tropism assays: Researchers use multiple cell types to assess viral tropism. ARPE-19 (retinal pigment epithelial) and MRC-5 (lung fibroblast) cells are commonly used to test HCMV tropism in vitro .

  • Neutralization assays: Cell-type specific neutralization assays can reveal the importance of specific viral proteins for entry into different cell types. These assays involve incubating virus with diluted sera and then infecting different cell types, with readouts such as fluorescence from reporter viruses .

What approaches are used to study the dynamics of US19 expression during different phases of HCMV infection?

To study temporal expression patterns of viral proteins like US19:

  • Kinetic classification: HCMV proteins are often classified based on their expression kinetics (e.g., immediate early, early, late). For example, ORFL147C was shown to be expressed with Tp4 kinetics .

  • Time-course experiments: Sampling infected cells at various time points post-infection allows researchers to track protein expression over the course of infection.

  • Reporter systems: Fusion of fluorescent proteins or epitope tags to viral proteins enables real-time monitoring of expression in live cells.

  • Immunoblotting: Western blot analysis of infected cell lysates collected at different time points can provide quantitative data on protein expression levels.

How can structural biology approaches be applied to understand US19 function?

Structural biology offers powerful tools for understanding transmembrane protein function:

For transmembrane proteins like US19, cryo-EM has become increasingly valuable as it doesn't require crystallization, which is often challenging for membrane proteins. These structural approaches can reveal binding sites for interactions with host proteins and potential targets for therapeutic intervention.

How does US19 fit within the broader context of HCMV's manipulation of host cell processes?

HCMV extensively modulates host cells, downregulating over 900 human proteins during viral replication and degrading at least 133 proteins shortly after infection . Understanding US19's role within this complex system requires integrative approaches:

  • Network analysis: Interactome studies of HCMV proteins have identified networks of over 3400 virus-host protein interactions . Placing US19 within these networks can provide insights into its functional context.

  • Enrichment analysis: This approach can identify over-represented biological processes among interacting proteins. For example, enrichment analysis of ORFL147C HCIPs suggested functions in RNA binding, mRNA splicing, or transcription .

  • Comparative virology: Comparing US19 with homologous proteins in other cytomegaloviruses, such as rhesus CMV (RhCMV), can provide evolutionary insights into conserved functions. RhCMV has been found to encode vFcγRs (Rh05, Rh152/151, and Rh173) with functional similarities to their HCMV orthologs .

What computational tools are most effective for predicting US19 function based on sequence and structural features?

Several computational approaches can help predict functions of poorly characterized viral proteins like US19:

  • Homology modeling: Using known structures of similar proteins to predict the structure of US19.

  • Sequence-based predictions: Tools like TMHMM for transmembrane domain prediction have been successfully applied to HCMV proteins .

  • Protein-protein interaction prediction: Algorithms that predict protein interactions based on sequence features, domain composition, and evolutionary conservation.

  • Functional domain identification: Identification of conserved functional domains can provide clues to protein function, as demonstrated by the prediction of SH3 domain binding by the viral UL25 protein .

How might understanding US19 function contribute to HCMV vaccine development?

While specific information on US19's role in vaccine development is not available in the search results, the methodology for investigating viral proteins in vaccine contexts can be derived from HCMV vaccine studies:

  • Attenuated vaccine strains: Understanding the contribution of specific viral proteins to virulence and immunogenicity is crucial for designing attenuated vaccines. For example, the Towne vaccine strain contains mutations in several genes (RL13, UL1, UL40, UL130, and US1) that were presumably acquired during in vitro passage and are implicated in attenuation .

  • Immunogenicity assessment: T-cell and antibody responses to specific viral proteins can be assessed using techniques such as intracellular cytokine staining (ICS) and neutralizing antibody assays, as demonstrated in the evaluation of chimeric HCMV vaccines .

  • Chimeric approaches: The construction of chimeric viruses, such as the Towne/Toledo chimeras, represents a strategy to improve vaccine immunogenicity while maintaining safety. Similar approaches might be applied to modify US19 or related proteins .

What is the potential of US19 as a target for antiviral drug development?

Viral transmembrane proteins can serve as valuable targets for antiviral development:

  • Small molecule inhibitors: Compounds that specifically bind to functional domains of US19 could potentially disrupt its activity and inhibit viral replication.

  • Peptide inhibitors: Designed peptides that mimic binding partners of US19 might compete for interaction sites and interfere with protein function.

  • Antibody-based therapeutics: If US19 has extracellular domains, therapeutic antibodies could potentially neutralize its function.

  • Gene editing approaches: CRISPR-Cas9 or similar technologies could target US19 sequences in the viral genome as an experimental therapeutic approach.

What are the most promising new technologies for studying HCMV transmembrane proteins like US19?

Emerging technologies are revolutionizing the study of viral transmembrane proteins:

  • Cryo-electron tomography: This technique allows visualization of proteins in their native cellular environment without extraction or purification.

  • Single-molecule tracking: Advanced microscopy techniques enable tracking of individual protein molecules in living cells, revealing dynamics not apparent in population studies.

  • Proximity labeling: Techniques like BioID or APEX2 can identify proteins in close proximity to US19 in living cells, providing spatial information about protein interactions.

  • CRISPR-Cas9 screening: Genome-wide screens can identify host factors required for US19 function or affected by US19 expression.

How might systems biology approaches advance our understanding of US19 in the context of HCMV infection?

Integrative approaches combining multiple data types can provide comprehensive understanding of viral protein functions:

  • Multi-omics integration: Combining proteomics, transcriptomics, and metabolomics data can reveal how US19 affects multiple cellular processes.

  • Temporal analyses: Studying changes in host-virus interactions over the course of infection can reveal the dynamic role of US19.

  • Mathematical modeling: Computational models of viral replication incorporating US19 function could predict the consequences of targeting this protein.

  • Comparative virology: Analyses comparing US19 with homologous proteins across different cytomegaloviruses can identify conserved functions and species-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.