Recombinant Human cytomegalovirus Uncharacterized protein HVLF2 (US16)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Cytomegalovirus US16 Protein

The US16 protein (also referred to as HVLF2 in some databases) is a predicted seven-transmembrane protein encoded by the US16 gene within the US12 family of Human Cytomegalovirus (HCMV). This gene family spans 10 contiguous genes (US12–US21) in the viral genome and is exclusive to cytomegaloviruses infecting higher primates . While its precise function remained uncharacterized until recent studies, US16 has emerged as a critical determinant of HCMV tropism and entry into endothelial and epithelial cells.

Functional Role in HCMV Infection

US16 is indispensable for viral entry and post-entry events in endothelial and epithelial cells but is dispensable in fibroblasts. This cell-type specificity is linked to its role in regulating the pentamer complex (gH/gL/UL128/UL130/UL131A), which is critical for infection of non-fibroblast cells .

Key Observations

  • Replication Defects: US16-deficient viruses (e.g., TRΔUS16) exhibit >100-fold reduced growth in microvascular endothelial cells (HMVECs) and retinal pigment epithelial cells (ARPE-19), but replicate normally in fibroblasts .

  • Defective Entry: Nuclear localization of tegument protein pp65 and viral DNA is impaired in US16-null infections, indicating a block during capsid disassembly or genome release .

Experimental Findings and Mutant Studies

Studies using US16-deficient mutants (e.g., TRΔUS16, TRUS16stop) confirm its essential role in tropism. Below is a comparison of phenotypes:

MutantCell TypeReplication OutcomeKey DefectReference
TRΔUS16 (deletion)FibroblastsNormal replicationNone
TRΔUS16 (deletion)HMVECs/ARPE-19Severe growth defectImpaired IE mRNA expression, pp65/DNA nuclear localization
TRUS16stop (stop codon)HMVECs/ARPE-19Identical defect as TRΔUS16Confirmatory evidence for US16’s role
TRUS16-REV (revertant)HMVECs/ARPE-19Rescued replicationValidates US16 specificity

Mechanism of Action and Interactions

US16 influences pentamer complex incorporation into virions, a process critical for entry into endothelial/epithelial cells. Key mechanistic insights:

Interaction/ProcessDetailReference
Pentamer DeficiencyUS16-null virions lack pentamer proteins, impairing entry into target cells
ColocalizationpUS16 co-localizes with pentamer components in the cVAC
Protein InteractionsCo-immunoprecipitation confirms binding to pUL130 (pentamer component)
C-terminal DeletionTruncation abolishes pentamer incorporation but not cVAC trafficking

Implications for HCMV Pathogenesis and Research

  • Tropism Regulation: US16 is a novel tropism factor enabling HCMV to infect non-fibroblast cells, such as endothelial and epithelial cells .

  • Therapeutic Target: Disruption of US16-pentamer interactions may offer a strategy to limit HCMV spread in vivo.

  • Strain-Specific Differences: The requirement for US16 differs between laboratory strains (e.g., AD169) and clinical isolates (e.g., TR strain), highlighting the importance of strain selection in functional studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preference for a particular tag type, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
US16; Uncharacterized protein HVLF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Target Names
US16
Target Protein Sequence
MGLRFPTATQRQIVFRRLFDSGNNDDYDEAAVVAVLGWVHRFEVVVRIAGLLLFQISAAV AVLGSFSLVFPTATLKSRPGFPCHVVWAPEVLLLVPVASALFVYFRYERPVLAQRNRHPR CRRPFRQLVLLLAGLLAHIPALGVTCACQEPREVLTSFVLTLVITLLCAEVVFICRDNCT LSDQFTLINGVWVVVFLVNVLIVFTRPWTWPLRLLLGFYSTVGLIFAGHFSQQVLFVRHV LMPRDVAHTSLQLFITFISLFFLILRIRNCQDLLSDLRLLELPSSDAMTLTPNDLSHASS STPLSTLSP
Uniprot No.

Target Background

Protein Families
Cytomegalovirus US12 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the US16 gene and what protein does it encode?

The US16 gene belongs to the US12 gene family of HCMV, which comprises 10 contiguous genes (US12 to US21), each encoding a predicted seven-transmembrane protein. The US16 protein (pUS16) has an apparent molecular mass of approximately 33 kDa, which aligns with its predicted size of 36 kDa when tagged with an HA epitope . Unlike many HCMV genes, US16 inactivation in clinical isolates produces pronounced cell-type specific effects, making it a critical determinant of viral tropism.

What is the expression pattern of the US16 protein during viral infection?

The US16 protein exhibits true late (L) gene kinetics during HCMV infection. In experimental studies using recombinant HCMV expressing HA-tagged US16, the protein becomes detectable at approximately 48 hours post-infection (p.i.) and remains present until at least 96 hours p.i . The expression is completely inhibited in the presence of foscarnet (PFA), a viral DNA polymerase inhibitor, confirming its classification as a true late gene . This expression pattern suggests pUS16 functions primarily during the later stages of viral replication.

Where is the US16 protein localized in infected cells?

Immunofluorescence studies using HA-tagged US16 have demonstrated that pUS16 accumulates in the cytoplasmic virion assembly compartment of infected cells . This localization pattern is consistent with potential roles in virion assembly or the regulation of virus-host interactions during late stages of infection.

How can researchers generate US16-deficient HCMV mutants for functional studies?

Researchers can generate US16-deficient viruses using several well-established approaches:

  • Replacement Strategy: The US16 coding region can be replaced with a marker cassette (such as galK) using bacterial artificial chromosome (BAC) technology. This approach was utilized to create TRΔUS16, where the US16 coding region was completely removed .

  • Nonsense Mutation Approach: Introduction of stop codons near the start of the US16 ORF through targeted mutations. This method was employed to create TRUS16stop, where a 3-bp change created a premature stop codon .

Both strategies effectively eliminate pUS16 expression and produce similar phenotypes, providing complementary approaches to confirm specificity of observed effects. Importantly, revertant viruses should be generated to confirm that any phenotypes are specifically due to US16 disruption.

What cell types are essential for comprehensive analysis of US16 function?

A multi-cell type experimental design is crucial for US16 functional studies:

Cell TypeDescriptionUS16 RequirementKey Observations
Fibroblasts (HELFs)Primary human embryonic lung fibroblastsMinimal effectUS16-deficient viruses show near normal replication (~1 log reduction)
HMVECsHuman microvascular endothelial cellsEssentialUS16-deficient viruses exhibit ~5 log reduction in viral titers
ARPE-19Retinal pigment epithelial cellsEssentialUS16-deficient viruses show severe growth defect

This cell panel allows researchers to distinguish between cell-type specific and general viral replication defects. The dramatic differences in replication efficiency between fibroblasts and endothelial/epithelial cells highlight the specialized role of US16 in HCMV tropism .

How can researchers confirm phenotypes are specifically due to US16 disruption?

To establish phenotype specificity, researchers should implement several controls:

  • Generate multiple independent US16 mutant viruses (e.g., both deletion and stop codon mutants) .

  • Create revertant viruses where the wild-type US16 sequence is restored (e.g., RVTRUS16-REV) .

  • Confirm that the expression of neighboring genes (US15 and US17) is not affected by US16 modification using quantitative real-time RT-PCR .

  • Demonstrate rescue of phenotype through complementation with functional US16.

In published studies, both TRΔUS16 and TRUS16stop mutants showed identical phenotypes, which were fully rescued in the revertant virus, confirming specific attribution to US16 function .

What is the molecular mechanism by which US16 affects HCMV tropism?

Current evidence suggests US16 functions during a very early phase of the viral replication cycle in endothelial and epithelial cells:

  • The block occurs prior to immediate-early (IE) gene expression, as demonstrated by the absence of IE1 and IE2 expression in endothelial cells infected with US16-deficient viruses .

  • US16-deficient viruses fail to deliver tegument protein pp65 to the nucleus in both endothelial and epithelial cells, despite normal delivery in fibroblasts .

  • Viral DNA fails to accumulate in the nuclei of endothelial cells infected with US16-deficient viruses, as demonstrated by cell fractionation studies .

  • Virion binding assays indicate that US16 does not significantly affect virus adsorption to cell surfaces .

These findings collectively indicate that US16 regulates a phase of the HCMV replication cycle occurring after virion attachment but prior to the release of viral genomes into the nucleus . The mechanism likely involves virus entry, capsid transport to nuclear pores, or genome release into the nucleus.

How might US16 interact with the gH/gL/pUL complex for cell tropism regulation?

The phenotype of US16-deficient viruses remarkably resembles that of HCMV mutants lacking components of the gH/gL/pUL complex, which is essential for entry into endothelial and epithelial cells. This similarity suggests several hypotheses:

  • US16 may directly interact with components of the gH/gL/pUL complex to regulate its assembly or function.

  • US16 could function in parallel pathways that complement gH/gL/pUL complex activity during entry.

  • US16 might regulate cellular receptors or post-entry processing mechanisms specific to endothelial and epithelial cells.

Research approaches to test these hypotheses should include co-immunoprecipitation studies, proximity labeling methods to identify interaction partners, and comparative analysis of entry kinetics between US16-deficient viruses and those lacking gH/gL/pUL components .

What explains the contradictory findings regarding US16 function in different HCMV strains?

  • The Towne strain contains an inactivating mutation in the UL130 gene (a double-T-nucleotide insertion), which generates a frameshift that compromises protein stability and incorporation into virions .

  • This UL130 mutation prevents formation of gH/gL/pUL complexes and their export to the cell surface, conferring reduced tropism for endothelial and epithelial cells independent of US16 status .

  • In the context of already compromised entry machinery (defective gH/gL/pUL complex), the phenotypic effect of US16 deletion may manifest differently, potentially revealing secondary functions.

This highlights the importance of using clinical isolates with intact entry machinery when studying tropism factors like US16.

What techniques effectively assess viral entry defects in US16-deficient viruses?

Multiple complementary approaches can evaluate entry phenotypes:

  • Virion Binding Assay: Using radiolabeled virions to quantify attachment to different cell types. Published data indicate US16-deficient viruses bind normally to endothelial cells .

  • pp65 Nuclear Localization: Monitoring nuclear accumulation of tegument protein pp65 by immunofluorescence at early time points (4-8 hours post-infection). US16-deficient viruses show defective nuclear accumulation of pp65 in endothelial and epithelial cells .

  • Cell Fractionation with Viral DNA Quantification:

    • Nuclear and cytoplasmic fractions are prepared from infected cells

    • Fraction purity is verified by markers (tubulin for cytoplasm, RNPA2 for nucleus)

    • Viral DNA in each fraction is quantified by real-time PCR

    • Results show significantly reduced viral DNA in nuclear fractions of cells infected with US16-deficient viruses

  • Time-course protein expression analysis: Comparing the expression of viral proteins representing different kinetic classes (immediate-early, early, and late) between wild-type and US16-deficient viruses .

How can researchers quantitatively assess the impact of US16 deficiency on viral replication?

Quantitative assessment requires multiple measurement approaches:

Analysis MethodTechnical ApproachKey Findings for US16-deficient Viruses
Growth Curve AnalysisMultiple-timepoint viral titer determination~5 log reduction in endothelial cells; minimal effect in fibroblasts
Viral mRNA QuantificationReal-time RT-PCR of IE1/IE2 transcriptsNear absence of IE gene expression in endothelial cells
Protein Expression AnalysisImmunoblotting for IE, E, and L proteinsSubstantial inhibition of viral protein expression in endothelial and epithelial cells
Nuclear Viral DNA AnalysisCell fractionation followed by qPCRSignificantly reduced viral DNA in the nuclear fraction

These complementary approaches provide a comprehensive assessment of the stage at which the US16-deficient virus replication cycle is blocked.

What approaches can determine if US16 functions directly in viral entry or affects entry indirectly?

To distinguish direct from indirect effects:

  • Temporal knockout studies: Using inducible expression systems to determine when US16 function is required.

  • Compositional analysis of virions: Determine if US16 deletion affects the incorporation of gH/gL/pUL complexes or other entry factors into virions.

  • Entry intermediate capture: Use synchronized infection protocols with temperature shifts or chemical inhibitors to capture entry intermediates and determine which step is affected.

  • Single-particle tracking: Utilize fluorescently labeled viral particles to track individual virion fate during entry in the presence or absence of US16.

  • Cellular receptor analysis: Investigate whether US16 affects the expression or localization of known HCMV entry receptors in endothelial and epithelial cells.

How should viral kinetics data from US16 studies be analyzed and presented?

For robust analysis of US16-dependent viral kinetics:

  • Growth curves should include multiple timepoints (minimum 0, 2, 4, 6, 8, 10, and 12 days post-infection) to fully capture replication dynamics .

  • Use logarithmic scale for viral titers to properly visualize the magnitude of differences (which can reach 5 logs for US16-deficient viruses in endothelial cells) .

  • Include both wild-type virus, US16-deficient viruses, and revertant controls to confirm phenotype specificity .

  • Test multiple independent US16 mutants (e.g., both deletion and stop codon variants) to rule out off-target effects .

  • Accompany growth curve data with molecular analyses (viral DNA quantification, protein expression) to determine the stage at which replication is blocked.

What control experiments are essential when studying cell-type specific effects of US16?

To establish robust cell-type specificity:

  • Normalize infection conditions across cell types using genome copy number rather than PFU, as the PFU/particle ratio may vary between cell types .

  • Verify cell fractionation quality when comparing nuclear delivery of viral components using markers like tubulin (cytoplasmic) and RNPA2 (nuclear) .

  • Normalize viral DNA measurements to cellular genes (e.g., 18S) to account for potential differences in cell number or extraction efficiency .

  • Ensure timing of analyses is appropriate for each cell type, as the viral replication cycle may progress at different rates.

  • Include positive controls for each assay in each cell type to confirm the technique works effectively across different cellular backgrounds.

How can researchers determine the structural features of US16 critical for its function?

Structure-function analysis of US16 should employ:

  • Systematic mutagenesis of predicted transmembrane domains: As a predicted seven-transmembrane protein, each domain could be individually mutated to assess its contribution to function.

  • Charged amino acid scanning: Introducing charged residues at various positions can disrupt membrane topology and reveal functional domains.

  • Epitope insertion analysis: Strategic insertion of epitope tags at different positions can map accessible regions while potentially preserving function.

  • Chimeric protein construction: Creating fusion proteins between US16 and other US12 family members to map domains responsible for cell-type specificity.

  • Conservation analysis: Comparing US16 sequences across HCMV clinical isolates and laboratory strains to identify highly conserved regions likely essential for function.

These approaches would help define the critical structural elements of US16 required for its role in viral entry into endothelial and epithelial cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.