Recombinant Human cytomegalovirus Uncharacterized protein HVLF4 (US14)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Cytomegalovirus Uncharacterized Protein HVLF4 (US14)

Recombinant Human cytomegalovirus Uncharacterized protein HVLF4 (US14) is a transmembrane protein encoded by the US14 gene of Human Cytomegalovirus (HCMV) strain AD169, a β-herpesvirus. This protein is produced via in vitro expression in E. coli systems and serves as a research tool for studying HCMV pathogenesis and immune evasion mechanisms .

Protein Structure

  • Gene: US14 (UniProt ID: P09719)

  • Expression System: E. coli-derived recombinant protein

  • Sequence: 310 amino acids with an N-terminal 10xHis tag .

    • Key domains: Transmembrane regions critical for viral envelope integration .

Physicochemical Properties

PropertyDetail
Molecular Weight~35 kDa (predicted)
Storage Conditions-20°C (short-term); -80°C (long-term)
PurityFull-length protein, confirmed by SDS-PAGE
TagN-terminal 10xHis

Experimental Use Cases

  • Antigen production: Used to generate antibodies for serological assays .

  • Structural studies: Characterization of transmembrane domains and post-translational modifications .

  • Vaccine development: Comparative studies with attenuated HCMV strains (e.g., Towne/Toledo chimeras) .

Key Challenges

  • Low immunogenicity: Limited antibody detection in clinical sera compared to immunodominant HCMV proteins (e.g., UL144) .

  • Functional redundancy: Overlapping roles with other HCMV immune evasion genes (e.g., US11, UL144) .

Association with Viral Loads

While US14 itself is not directly linked to clinical outcomes, HCMV genotypes in the UL/b' region (e.g., UL144) correlate with:

  • High plasma viral loads (PVLs) in congenital infections .

  • Developmental sequelae in infants .

Genomic Context

US14 resides in a genomic region prone to recombination, contributing to HCMV's high genetic diversity . Comparative studies show:

  • Geographical variation: African vs. European strain divergence in conserved regions .

  • Balancing selection: Maintenance of immunomodulatory allele diversity across populations .

Technical Notes for Handling

  • Stability: Avoid repeated freeze-thaw cycles; aliquot working stocks .

  • Detection: Western blotting recommended due to intracellular retention .

Future Directions

  • Functional characterization: CRISPR-based knockout studies to delineate US14-specific roles.

  • Therapeutic targeting: Exploration as a biomarker for HCMV reactivation in immunocompromised patients .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
US14; Uncharacterized protein HVLF4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Target Names
US14
Target Protein Sequence
METVSTQRETASSETERTREAASAETTDATFRSLEEGSTISSRYSETASTVSEDAVCWLR RTAIVMRVYGLLTLETAFSVLISALVWLGYPSLGYKCSDDPSPLLLSCTPVLVLGALELT DHRHPSNGLVFALYVALLSFTTAGLNLCATAPIGISSLILTWTLFVACNGVAWEHRLSSV WRDALFTSTLLTVMVSVLASTYTWLHKTLLCLYTVFVGCILAVLFQDVRYIATKMPVSHV IRSSLILYATETLIYHTTLLMLTPVVWSARWDQMFSYLAKLGTYHHYLIDNGTLSVILNT TTATFQSKAA
Uniprot No.

Target Background

Protein Families
Cytomegalovirus US12 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and basic characteristics of HCMV US14?

US14 is a protein encoded within the unique short (US) region of the human cytomegalovirus genome. Like many HCMV proteins, US14 remains largely uncharacterized despite HCMV having the largest genome amongst human herpesviruses (~236 kb with approximately 180 genes) . The protein belongs to the US12 gene family, which includes a set of related proteins (US12-US21) that share structural similarities. Based on sequence analysis, US14 is predicted to be a multi-pass transmembrane protein with potential roles in immune evasion or viral replication.

How does US14 expression change during the different phases of HCMV infection?

US14 expression patterns vary across the viral replication cycle. While detailed temporal expression data specifically for US14 is limited, most HCMV genes follow characteristic temporal expression patterns (immediate-early, early, and late). Understanding when US14 is expressed can provide crucial clues about its function.

Methodological approach: To characterize US14 expression kinetics, researchers should perform time-course experiments using quantitative PCR and western blotting after infection of permissive cell types. Inhibitors of viral DNA replication (like foscarnet) can help determine if US14 is an early or late gene. Additionally, analyzing US14 expression in different cell types is important since HCMV permissiveness varies significantly based on cell differentiation state .

What are the best expression systems for producing recombinant US14 protein for research?

Producing functional recombinant US14 presents challenges due to its predicted transmembrane domains. Several expression systems have relative advantages depending on research objectives.

Methodological approach: For structural studies, bacterial systems (E. coli) with fusion tags (His, GST, MBP) can produce protein fragments, though full-length expression may require eukaryotic systems. Baculovirus-insect cell systems often provide better yields for membrane proteins while maintaining proper folding. Mammalian expression systems (typically HEK293 or CHO cells) offer the most authentic post-translational modifications but with potentially lower yields. When designing expression constructs, consider epitope tags that don't interfere with protein function and codon optimization for the host system.

What are the optimal cell culture models for studying US14 function?

Selecting appropriate cell models is critical for US14 functional studies, as HCMV exhibits strict cell tropism and differential gene expression patterns across cell types.

Methodological approach: Primary human fibroblasts (MRC-5, WI-38) represent the gold standard for HCMV replication studies. For immune interaction studies, models should include monocyte/macrophage lineages, as these represent important sites of HCMV latency . When investigating US14 in isolation (outside the context of viral infection), researchers should compare results across multiple cell types, including epithelial cells (ARPE-19), endothelial cells, and cells of myeloid origin. Similar to approaches used for US27 , proximity ligation assays (PLA) can detect protein-protein interactions involving US14, potentially identifying binding partners that could reveal function.

What techniques are most effective for detecting US14 localization and trafficking?

Understanding where US14 localizes within infected cells provides important functional insights.

Methodological approach: Researchers should employ complementary approaches:

  • Immunofluorescence microscopy with antibodies against US14 or epitope-tagged versions

  • Subcellular fractionation followed by western blotting

  • Live-cell imaging using fluorescent protein fusions (if function is preserved)

  • Electron microscopy for high-resolution localization

Co-localization studies with cellular organelle markers (ER, Golgi, endosomes, plasma membrane) are essential. For trafficking studies, techniques used to study other viral transmembrane proteins like US27, which exhibits "punctate and perinuclear localization" , may be adapted for US14.

How can CRISPR-Cas9 technology be applied to study US14 function?

CRISPR-Cas9 gene editing provides powerful approaches for investigating US14 function within the viral genome context.

Methodological approach: Researchers can employ several strategies:

  • Generate US14-knockout HCMV strains using CRISPR-Cas9 editing of viral bacterial artificial chromosomes (BACs)

  • Create US14 mutants with specific domain deletions or point mutations

  • Implement CRISPR activation or interference systems to modulate US14 expression

  • Perform CRISPR screens to identify host factors interacting with US14

When designing guide RNAs, researchers should carefully analyze the US14 locus to avoid disrupting overlapping genes or regulatory elements. Phenotypic comparisons between wild-type and US14-mutant viruses should include growth curve analysis, cell tropism assessment, and immune evasion function testing.

What is the role of US14 in immune evasion during HCMV infection?

Many HCMV US region proteins function in immune evasion, suggesting US14 may play a similar role. HCMV dedicates a significant portion of its genome to immune modulation, with viral strategies targeting both innate and adaptive responses.

Methodological approach: Researchers should investigate whether US14 affects:

  • Antigen presentation (MHC-I or MHC-II pathways)

  • Natural killer cell recognition

  • Cytokine signaling

  • Pattern recognition receptor pathways

Experimental systems should compare wild-type virus with US14-deletion mutants, examining immune recognition outcomes. Additionally, single-expression systems can determine if US14 alone is sufficient for specific immune evasion phenotypes. Analysis should include quantitative measurements of surface MHC molecules, cytokine production, and immune cell activation markers.

Does US14 interact with other viral proteins or host cell factors?

Understanding the interaction network of US14 would provide significant insights into its function. Similar to how "CXCR4, IL-10R, and US27 form a novel virus-host signaling complex" , US14 may participate in multiprotein complexes.

Methodological approach: Several complementary techniques should be employed:

  • Co-immunoprecipitation (co-IP) followed by mass spectrometry

  • Yeast two-hybrid screening

  • Proximity labeling (BioID, APEX) in infected cells

  • Proximity ligation assay (PLA) for candidate interactions

  • FRET or BRET to confirm direct interactions

Table 1: Comparison of Protein Interaction Detection Methods for US14 Research

MethodAdvantagesLimitationsSample Preparation Requirements
Co-immunoprecipitationDetects native complexesMay miss transient interactionsRequires specific antibodies or epitope tags
Proximity Ligation AssayVisualizes interactions in situRequires candidate knowledgeFixed cells with validated antibodies
BioID/APEXIdentifies proximal proteinsMay label non-interacting proteinsExpression of fusion proteins
Yeast Two-HybridSystematic screening capabilityHigh false positive rateLibrary construction and screening
FRET/BRETConfirms direct interactionsRequires fluorescent taggingLive cells expressing fusion proteins

How does genetic variation in US14 across clinical HCMV strains affect viral pathogenesis?

HCMV exhibits significant strain variation, which may impact US14 function and contribute to differential virulence. Previous studies have shown that "25% [of infected individuals] shared a single common strain" , highlighting the existence of predominant viral variants.

Methodological approach: Researchers should:

  • Sequence US14 from diverse clinical isolates (blood, urine, saliva samples)

  • Perform phylogenetic analysis to identify conserved and variable regions

  • Generate chimeric viruses with US14 variants from different strains

  • Test phenotypic differences in replication and immune evasion

  • Consider the impact of US14 variation in different tissue contexts

Analysis should focus on correlating specific sequence variations with functional outcomes, possibly revealing structure-function relationships.

What is the protein structure of US14 and how does it inform function?

Methodological approach: Researchers should consider a multi-faceted approach:

  • Prediction using AlphaFold2 or other computational methods

  • X-ray crystallography of soluble domains (if present)

  • Cryo-electron microscopy for full-length protein

  • NMR for dynamic regions

  • Cross-linking mass spectrometry to identify domain interactions

Structure-function analysis can be performed through systematic mutagenesis of predicted functional motifs, followed by functional assays to determine the impact of specific structural elements.

How can post-translational modifications of US14 be characterized?

Post-translational modifications (PTMs) often regulate protein function and may be critical for US14 activity during infection.

Methodological approach: Researchers should identify PTMs through:

  • Mass spectrometry analysis of purified US14

  • Site-directed mutagenesis of predicted modification sites

  • Metabolic labeling approaches for specific modifications

  • PTM-specific antibodies when available

Particular attention should be paid to phosphorylation, glycosylation, and ubiquitination, as these modifications frequently regulate viral protein function. Temporal analysis of PTMs throughout the infection cycle may reveal regulatory mechanisms.

Could US14 serve as a target for anti-HCMV therapeutics or vaccine development?

Novel therapeutic approaches against HCMV are needed, especially given the modest efficacy of existing vaccines. Live attenuated HCMV vaccines based on the Towne strain have shown "moderate efficacy in other clinical settings" , but improvements are still needed.

Methodological approach: To evaluate US14 as a therapeutic target, researchers should:

  • Determine if antibodies against exposed domains of US14 neutralize viral infectivity

  • Screen for small molecule inhibitors of US14 function

  • Assess whether US14-deleted viruses could serve as attenuated vaccine candidates

  • Evaluate US14 peptides as potential T-cell epitopes for vaccine development

Functional importance and conservation across strains would make US14 a more attractive target. Researchers should compare results with other US region proteins with known therapeutic potential.

How does US14 compare functionally to similar proteins in other herpesviruses?

Comparative virology approaches may reveal conserved functions and evolutionary relationships.

Methodological approach: Researchers should:

  • Perform bioinformatic comparisons with other betaherpesviruses

  • Test functional complementation (can homologs substitute for US14?)

  • Identify conserved motifs that suggest functional importance

  • Create chimeric proteins to map functional domains

This comparative approach may uncover fundamental mechanisms shared across viral families and identify unique features of HCMV US14.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.