Recombinant Human cytomegalovirus Uncharacterized protein HWLF2 (US21)

Shipped with Ice Packs
In Stock

Description

Functional Role in HCMV Pathogenesis

The US21 protein is a calcium-permeable channel that depletes ER calcium stores, enabling HCMV to:

  • Modulate Calcium Homeostasis: Reduces ER Ca²⁺ content, triggering store-operated calcium entry (SOCE) .

  • Enhance Cell Migration: Promotes chemotaxis and adhesion by activating calpain 2 and interacting with talin-1, a focal adhesion protein .

  • Suppress Apoptosis: Protects infected cells from programmed cell death by disrupting calcium-dependent apoptotic pathways .

Mechanism of Calcium Signaling

  • US21 stimulates SOCE, leading to cytosolic Ca²⁺ influx and calpain 2 activation .

  • Mutations in pH-sensing residues (e.g., D201N) abolish its Ca²⁺-conducting activity, confirming its role as a functional channel .

Cell Migration and Adhesion

  • HCMV-infected cells lacking US21 show impaired migration, while recombinant US21 expression accelerates focal adhesion turnover .

  • Talin-1 knockdown abolishes US21-mediated migration, highlighting its dependency on focal adhesion dynamics .

Interaction Network

  • US21 interacts with talin-1 and components of the ER stress response .

  • Cooperates with other HCMV proteins (e.g., UL20) to degrade host immune factors like IFNGR1 and FCGRT .

Research Applications

Recombinant US21 is utilized in:

  • Mechanistic Studies: Elucidating calcium signaling pathways in viral infection .

  • Drug Development: Screening inhibitors targeting viroporin activity .

  • Structural Biology: Resolving 7TMD architecture and pH-dependent gating mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
US21; Uncharacterized protein HWLF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-239
Protein Length
full length protein
Species
Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Target Names
US21
Target Protein Sequence
MSLRGQVQIARSVFLLRIYILIWVQCLILMSVCAFCWLVLPHRLEQLFSSVRLTLSCLMI SIVCLGLLRWAEPNFPKNVWILLTYTLLTSVAVTASGFHFSHRSVIYAMVATVTLFCFLT LATYLFARDVELQRSLLTGASTLILLLFAVFSLFPEAVSEILVMIAGLAVIVTSVVCDTQ DILHDIEYESYIPGALCLYMDLMYLFVSVLYFMPSEPGSAHTAQTTVAATAAASPQFVS
Uniprot No.

Target Background

Protein Families
Cytomegalovirus US12 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the US21 protein and where is it located in the HCMV genome?

The US21 protein is encoded by one of ten contiguous genes (US12-US21) that constitute the US12 gene family in the Human cytomegalovirus genome. Structurally, pUS21 is a 7-transmembrane domain (7TMD) protein that is expressed with late kinetics during viral infection and accumulates primarily in endoplasmic reticulum (ER)-derived vesicles . Phylogenetic analyses suggest that US21 may represent the initial point of entry of the US12 gene family into an ancestral primate CMV, as it is located on a well-diverged branch separate from other US12 proteins . The US21 gene appears to be a descendant of a precursor transmembrane BAX inhibitor motif-containing (TMBIM) gene captured by an ancestral primate CMV more than 40 million years ago .

What is the primary biochemical function of the US21 protein?

The US21 protein functions primarily as a calcium-permeable multitransmembrane channel (viroporin) that reduces the calcium content of intracellular endoplasmic reticulum stores . This calcium-conducting activity is dependent on critical residues including D178 and D201, with D201 being particularly essential as it appears to line the pUS21 pore . When comparing pUS21 with its cellular homologs, the D201 residue aligns with D213 of BI-1 (Bax inhibitor-1) and D219 of GAAP (Golgi anti-apoptotic protein), which are known to be crucial for channel conductance in these cellular proteins . Mutation of D201 prevents the pUS21-mediated reduction of calcium content in the ER, confirming its functional importance in the protein's viroporin activity .

How does US21 contribute to HCMV replication?

US21 is required for efficient HCMV replication across different cell types. Experimental evidence from multistep growth curves has demonstrated that US21-deficient viruses (TRΔUS21 and TRUS21stop) exhibit significantly impaired replication - more than 10²-fold lower in human foreskin fibroblasts (HFFs) and 10⁴-fold lower in endothelial cells (HMVECs) compared to wild-type virus . This replication defect is not due to impaired viral entry, as nuclear accumulation of pp65 delivered by US21-null virions remains comparable to wild-type virus . Instead, the defect manifests at post-entry phases, with US21-null viruses expressing lower levels of representative immediate-early (IE), early (E), and late (L) genes compared to wild-type HCMV . The reduction in viral gene expression becomes significant from 72 hours post-infection, coinciding with the time when pUS21 is fully expressed .

What experimental systems have been developed to study US21 function in isolation?

To elucidate the specific contribution of US21 to cellular processes, researchers have employed tetracycline-regulated expression systems (T-REx) for the efficient expression of different HA-tagged US21 proteins in human U2OS cells . This approach allows controlled expression of the viroporin, avoiding potential adverse effects on host cell physiology that might result from uninterrupted expression . The system has been validated for both tetracycline-inducible expression of pUS21 proteins and assessment of calcium-mobilizing activity .

Researchers have also used this system to express mutant variants, particularly pUS21-HA D178N and pUS21-HA D201N, in which the Asp178 and Asp201 residues of the conserved pH sensor were mutated to Asn . This experimental design enables comparative analysis of wild-type and mutant protein functions, demonstrating that D201N mutation abolishes calcium-conducting function while D178N retains activity .

How does US21 modulate cell migration and what methodologies are used to study this function?

The role of US21 in cell migration has been investigated using several complementary approaches:

  • Transwell migration assays: These assess the migration of human foreskin fibroblasts (HFFs) infected with wild-type HCMV (TRwt), US21-deleted virus (TRΔUS21), or revertant virus (TRUS21-HA) using FBS as a chemoattractant at different times post-infection .

  • Time-lapse microscopy: This technique evaluates random cell migration in T-REx-U2OS cells expressing wild-type or mutant US21 proteins by analyzing single-cell trajectories .

  • Chemotactic migration assays: Similar to transwell assays but specifically measuring directed migration towards a chemoattractant .

These methodologies have revealed that HFFs infected with wild-type or revertant virus show significantly increased cell migration as early as 24 hours post-infection, while cells infected with US21-deleted virus exhibit migration comparable to mock-infected cells . Similarly, in isolated expression systems, wild-type pUS21 and pUS21-D178N increase random cell migration, whereas the D201N mutant lacking calcium-conducting function has no significant effect . These findings establish a direct correlation between US21's calcium channel activity and its ability to stimulate cell migration.

What techniques are used to identify US21 protein interactions with host cell components?

To identify pUS21-interacting cellular partners, researchers have employed mass spectrometry analysis of pUS21-HA-coimmunoprecipitated complexes from non-induced or induced T-REx-U2OS cells . This approach has revealed that pUS21 interacts with talin-1, a crucial protein component of focal adhesion complexes and a substrate for calpain 2 .

The functional significance of this interaction has been validated through talin-1 knockdown experiments, which demonstrate that reducing talin-1 expression abrogates the pUS21-mediated increase in cell migration . This methodological approach exemplifies how protein-protein interaction studies can illuminate the mechanistic basis of viral protein functions in host cell manipulation.

Through what molecular mechanisms does US21 protect cells against apoptosis?

US21 protects cells against intrinsic apoptosis through its ability to alter intracellular calcium homeostasis . The protein's viroporin activity reduces the calcium content of ER stores, which has been directly linked to increased cell resistance to apoptosis . This functional relationship is evidenced by experiments with the D201N point mutation in the putative pore of pUS21, which impairs both the reduction of ER calcium concentration and the antiapoptotic activity of wild-type pUS21 .

What signaling pathways does US21 engage to promote cell migration?

US21 promotes cell migration through several interconnected molecular pathways:

  • Calcium homeostasis regulation: pUS21 expression stimulates store-operated calcium entry (SOCE), which promotes calcium influx and subsequent activation of calcium-dependent pathways .

  • Calpain 2 activation: Mechanistic studies have revealed that pUS21-mediated cell migration involves calpain 2 activation, as inhibition of this protease prevents the viroporin's effects on cell motility .

  • Focal adhesion dynamics: pUS21 stimulates focal adhesion dynamics in a manner dependent on its ability to manipulate ER calcium content .

  • Talin-1 interaction: pUS21 directly interacts with talin-1, a calpain 2 substrate and crucial component of focal adhesion complexes. Knockdown of talin-1 abrogates pUS21-mediated increases in cell migration, confirming the functional significance of this interaction .

This signaling cascade illustrates how US21 exploits fundamental cellular processes to facilitate virus-induced changes in host cell behavior.

How does the calcium-conducting activity of US21 compare with that of cellular TMBIM proteins?

FeaturepUS21 (HCMV)BI-1 (Cellular)GAAP (Cellular)
Key functional residueD201D213D219
Cellular localizationER-derived vesiclesERGolgi
Effect on ER Ca²⁺ storesReductionReductionReduction
Antiapoptotic activityYesYesYes
Effect on cell migrationStimulationNot fully characterizedNot fully characterized
Evolutionary originViral capture of TMBIM geneEndogenousEndogenous

The conservation of critical residues like D201 (aligning with D213 of BI-1 and D219 of GAAP) despite millions of years of divergent evolution underscores the functional importance of these amino acids in calcium channel activity . Mutation studies confirm that these conserved residues are essential for the ability of all three proteins to reduce calcium content in intracellular stores .

What are the challenges in studying US21 function in the context of full viral infection versus isolated expression?

Investigating US21 function presents several methodological challenges that require careful experimental design:

  • Temporal expression patterns: US21 is expressed with late kinetics during HCMV infection, making it difficult to distinguish its effects from those of other viral proteins expressed simultaneously . Inducible expression systems help overcome this limitation by allowing controlled expression of US21 in isolation .

  • Redundancy in viral functions: HCMV encodes multiple proteins that modulate calcium signaling and cell death pathways, potentially masking US21-specific effects in the context of infection . Deletion mutants and complementation studies are essential to delineate US21's unique contributions .

  • Cell type specificity: US21-null viruses show more severe replication defects in endothelial cells (10⁴-fold reduction) than in fibroblasts (10²-fold reduction) , suggesting cell type-dependent functions that must be assessed across multiple cellular contexts.

  • Distinguishing direct from indirect effects: As a calcium channel, US21 influences numerous downstream calcium-dependent processes. Determining which cellular changes are direct consequences of US21 activity versus secondary effects requires careful pathway dissection .

Researchers address these challenges through complementary approaches, including viral genetics (gene deletions, point mutations), isolated protein expression systems, and comparative analyses across cell types and experimental conditions .

What experimental strategies can resolve contradictions in US21 research findings?

When confronting contradictory findings in US21 research, several strategic approaches can help resolve discrepancies:

  • Standardization of experimental systems: Different viral strains (laboratory-adapted versus clinical isolates) may exhibit variant US21 functions. Using consistent viral backgrounds and clearly reporting strain characteristics helps reconcile disparate results .

  • Temporal analysis: Given that US21 expression peaks late in infection, the timing of experiments is crucial. Comprehensive time-course studies can identify phase-specific effects that might otherwise appear contradictory .

  • Mutation-function correlation: The D201N mutation abolishes calcium channel activity and associated phenotypes, while D178N retains function . Such structure-function analyses can help resolve mechanistic contradictions by linking specific protein domains to discrete functions.

  • Combinatorial gene analyses: US21 belongs to a family of 10 genes with potential functional overlap. Studies examining single versus multiple gene deletions can clarify which phenotypes are US21-specific versus those requiring cooperative action of multiple family members .

  • Integration of in vitro and ex vivo findings: Reconciling results from cell culture systems with those from primary tissues or clinical samples helps validate the biological relevance of experimental findings .

How might epigenetic regulation influence US21 expression and function during different phases of HCMV infection?

While direct evidence on epigenetic regulation of US21 is limited in the provided search results, this represents an important avenue for future research. Several considerations for investigating epigenetic influences on US21 include:

  • Chromatin structure analysis at the US21 locus during different phases of infection using techniques such as ChIP-seq for histone modifications and ATAC-seq for chromatin accessibility.

  • DNA methylation profiling of the US21 promoter region across latent, reactivating, and lytic infection phases using bisulfite sequencing or similar approaches.

  • Non-coding RNA interactions that might regulate US21 expression, investigated through RNA immunoprecipitation and RNA-seq methodologies.

  • Comparative epigenetic landscapes across different cell types, particularly comparing permissive versus non-permissive cells for HCMV replication.

  • Temporal correlation between epigenetic modifications and US21 expression kinetics during the viral replication cycle.

Such investigations would help determine whether US21's late expression kinetics are controlled primarily by traditional viral gene regulation cascades or involve additional epigenetic regulatory layers.

What are the potential implications of US21 research for antiviral development?

Understanding US21 function has significant implications for novel antiviral strategies:

  • Direct targeting of US21 viroporin activity: The identification of US21 as a calcium channel with a defined pore region containing critical residues like D201 provides a potential target for small molecule inhibitors . Compounds that block this channel activity could significantly impair viral replication, as evidenced by the 10²-10⁴-fold reduction in replication observed with US21-null viruses .

  • Disruption of US21-host protein interactions: The interaction between US21 and talin-1 represents another targetable node, as this interaction is crucial for US21-mediated cell migration . Peptides or small molecules that prevent this interaction could disrupt virus-induced changes in host cell behavior.

  • Modulation of calcium signaling pathways: Rather than targeting US21 directly, interventions that normalize calcium homeostasis disrupted by US21 could potentially counteract its effects on cell survival and migration .

  • Combination approaches: Given that US21 is one of several HCMV proteins that modulate host immune responses and cell physiology, combination therapies targeting multiple viral immune evasion mechanisms might prove most effective .

These approaches represent promising avenues for future antiviral development, particularly for managing HCMV infections in immunocompromised individuals.

What cutting-edge technologies could advance our understanding of US21 structural biology?

Several emerging technologies could significantly enhance our understanding of US21 structure and function:

  • Cryo-electron microscopy (cryo-EM): This technique could reveal the three-dimensional structure of pUS21 in its native membrane environment, particularly focusing on the conformation of the calcium-conducting pore and the structural basis for the differential effects of D178N versus D201N mutations .

  • Single-particle tracking and super-resolution microscopy: These approaches could elucidate the dynamics of US21 trafficking and localization in infected cells with unprecedented spatial and temporal resolution.

  • Mass spectrometry-based structural proteomics: Techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) could provide insights into conformational changes associated with US21 channel activation and calcium flux.

  • AlphaFold and other AI-based structure prediction tools: These computational approaches could generate testable models of US21 structure, particularly in regions of low homology with cellular TMBIM proteins .

  • Nanobody development: Developing conformation-specific nanobodies against different states of the US21 channel could facilitate both structural studies and functional investigations in living cells.

These technological approaches would complement existing biochemical and cellular studies to provide a more comprehensive understanding of US21 structure-function relationships.

How does US21 compare with homologous proteins in other cytomegaloviruses?

The US21 protein represents an evolutionarily significant viral acquisition with interesting comparisons to homologs in other species:

  • Phylogenetic positioning: US21 appears to be the initial point of entry of the US12 gene family into an ancestral primate CMV, based on its location on a well-diverged branch separate from all other US12 proteins in phylogenetic analyses .

  • Evolutionary timeline: The capture of a precursor TMBIM gene by an ancestral primate CMV is estimated to have occurred more than 40 million years ago, explaining the relatively low level of conservation between pUS21 and modern TMBIM proteins despite retention of critical functional residues .

  • Selective pressures: Despite millions of years of evolution, key functional residues like D201 remain conserved, suggesting strong selective pressure to maintain calcium channel activity . This conservation underscores the importance of this function for viral fitness.

  • Species-specific adaptations: Comparative analysis of US21 homologs across different CMV species could reveal host-specific adaptations that reflect co-evolution with different primate immune systems.

Such evolutionary analyses provide context for understanding how US21 contributes to HCMV's sophisticated manipulation of host cell biology.

What insights can be gained from studying US21 in the context of the entire US12 gene family?

The US21 protein exists within the broader context of the US12 gene family, comprising 10 contiguous genes (US12-US21) with diverse functions in virus-host interactions . Several key insights emerge from studying US21 in this context:

  • Functional specialization: While other US12 family members regulate virus cell tropism (US16, US18, US20), virion composition (US16, US17), and evasion of natural killer cell activation (US12, US14, US18, US20), US21 has evolved a more defined biochemical function as a calcium channel . This functional divergence highlights how gene duplication events can lead to specialization within a family.

  • Temporal coordination: Many US12 family proteins are most abundant early in the replication cycle, suggesting coordinated expression and potential functional synergy in modulating host responses prior to productive infection .

  • Structural conservation: Despite functional divergence, US12 family members share a seven-transmembrane domain topology, indicating conservation of core structural features even as specific functions evolved .

  • Complementary immune evasion strategies: While US21 primarily affects calcium homeostasis and cell death pathways, other family members like US2 directly target MHC class I heavy chains for degradation . Together, these complementary mechanisms create a multi-layered defense against host immunity.

Understanding these relationships provides a more complete picture of how HCMV has evolved a sophisticated toolkit for manipulating host cell processes.

What are the key methodological considerations when generating and validating US21 mutants?

Creating and validating US21 mutants requires careful attention to several methodological aspects:

  • Selection of mutation sites: Critical residues like D178 and D201 have been identified based on homology with cellular TMBIM proteins . Successful mutation strategies should target such functionally important residues while also exploring non-conserved regions that might confer virus-specific functions.

  • Mutation validation strategies: Multiple approaches should be employed to confirm the effects of mutations:

    • Western blotting to verify protein expression levels

    • Subcellular localization studies to ensure proper trafficking

    • Calcium imaging to assess channel function

    • Functional assays for apoptosis protection and cell migration

  • Viral genome integration: When incorporating US21 mutations into the viral genome, researchers must ensure that modifications don't disrupt overlapping genes or regulatory elements. Bacterial artificial chromosome (BAC) technology has been successfully used for this purpose .

  • Reversion controls: Generation of revertant viruses (like TRUS21-HA) is essential to confirm that observed phenotypes are due to specific US21 mutations rather than unintended genomic alterations .

  • Cell type considerations: As US21 effects vary between cell types, mutant phenotypes should be assessed in multiple relevant cell types, including fibroblasts and endothelial cells .

What are the optimal approaches for quantifying US21-mediated changes in calcium homeostasis?

Accurate measurement of US21's effects on calcium homeostasis requires sophisticated technical approaches:

  • Ratiometric fluorescence imaging: This technique has been successfully employed to demonstrate that pUS21 expression reduces the calcium content of intracellular ER stores . Key advantages include:

    • Correction for variations in dye loading

    • Mitigation of photobleaching effects

    • Ability to perform quantitative comparisons across conditions

  • Store-operated calcium entry (SOCE) measurement: Since pUS21 expression stimulates SOCE mechanisms, protocols should include:

    • Store depletion with thapsigargin or similar agents

    • Calcium re-addition protocols to assess entry rates

    • Comparison between wild-type and mutant US21 effects

  • Single-cell calcium imaging: This approach allows assessment of cell-to-cell variability in response to US21 expression and can reveal subpopulations with distinct calcium dynamics.

  • Organelle-specific calcium probes: Targeted calcium indicators for the ER, Golgi, and mitochondria can provide compartment-specific information about US21's effects on calcium distribution.

  • Real-time measurements during infection: Developing systems for monitoring calcium dynamics throughout the course of HCMV infection can reveal the temporal relationship between US21 expression and calcium homeostasis alterations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.