Recombinant Human cytomegalovirus Uncharacterized protein UL1 (UL1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
UL1; Glycoprotein UL1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Target Names
UL1
Target Protein Sequence
MGMQCNTKLLLPVALIPVVIILIGTLVPILLHEQKKAFYWRLFLQSQHVEAPITVTQGDT VYLDASNNPCNYSSFWYHGNCELCGWNGYLRNVTHYYTNTSCSPQFMCINETKGLQLYNV TLNDSGAYTEHVYECDLSCNITTYNEYEILNYFDNCNYTINSTKHIITVVSSRHSKQTNS HVSTHAGWAAAVVTVIMIYVLIHFNVPATLRHKLRTRNNVNRIA
Uniprot No.

Target Background

Protein Families
RL11 family
Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

What is UL1 and which protein family does it belong to?

UL1 is a member of the rapidly evolving HCMV RL11 gene family. It encodes a 224-amino-acid type I transmembrane glycoprotein that becomes detectable at 48 hours post-infection in infected cells . The protein appears to be HCMV-specific, as it is notably absent in chimpanzee cytomegalovirus (CCMV) . When studying UL1, researchers should consider its relationship to other RL11 family members, as this context provides important evolutionary and functional insights.

What structural characteristics define UL1?

UL1 is expressed as a 224-amino-acid type I transmembrane glycoprotein . Sequence similarity analyses reveal that pUL1 shows significant homology to the N-terminal immunoglobulin (Ig) domain of the cellular carcinoembryonic antigen-related (CEA) protein family, which is responsible for CEA ligand recognition . This similarity suggests potential roles in molecular recognition and cellular interactions. Researchers investigating UL1 structure should employ glycosylation analysis methods and consider the implications of its transmembrane topology.

How can we approach functional annotation of UL1 as a previously uncharacterized protein?

As UL1 was previously uncharacterized, its functional annotation requires multiple complementary approaches:

  • Computational prediction: Apply homology-based methods, database searches for physiochemical properties, subcellular localization prediction, protein classification, and domain/motif analysis .

  • Experimental validation: Confirm predictions through techniques including:

    • Chromatographic separations (gel filtration, ion-exchange, affinity chromatography)

    • Electrophoretic analysis (SDS-PAGE)

    • Mass spectrometry for protein identification

  • Interaction studies: Identify protein-protein interactions using microarray technologies and protein expression profiling to understand UL1's role in biological systems .

What is the evolutionary origin of UL1?

Sequence analysis studies suggest that UL1 may have originated through duplication of an ancestor gene from the RL11-TRL cluster (specifically TRL11, TRL12, and TRL13) . This evolutionary mechanism is common in viral genomes and contributes to functional diversification. When studying UL1 evolution, researchers should employ comparative genomics approaches across cytomegalovirus species to track evolutionary patterns.

Why is UL1 particularly interesting from an evolutionary perspective?

UL1 is especially noteworthy because it is HCMV-specific and absent in closely related viruses like chimpanzee cytomegalovirus (CCMV) . This specificity suggests a recent evolutionary origin and possible adaptation to human hosts. Researchers interested in UL1 evolution should consider applying selection pressure analysis methods to identify potential adaptive mutations that may have arisen during human-specific evolution.

When is UL1 expressed during the viral replication cycle?

Northern blot analysis reveals that UL1 is transcribed during the late phase of the viral replication cycle in both fibroblast-adapted and endotheliotropic strains of HCMV . This temporal expression pattern provides important clues about its potential role in virion assembly or maturation processes. To study UL1 expression kinetics, researchers should:

  • Isolate whole-cell RNA from infected cells at various time points post-infection (8, 24, 48, and 72 hours)

  • Perform Northern blot analysis using digoxigenin (DIG) system for detection

  • Compare expression patterns across different viral strains

Where does UL1 localize in infected cells?

In infected human fibroblasts, pUL1 colocalizes at the cytoplasmic site of virion assembly and secondary envelopment with:

  • TGN-46 (a marker for the trans-Golgi network)

  • Viral structural proteins, including envelope glycoprotein gB

  • Tegument phosphoprotein pp28

To study UL1 localization, immunofluorescence microscopy protocols should include:

  • Infecting appropriate cells (e.g., MRC-5) with tagged UL1 constructs

  • Fixing cells in 4% paraformaldehyde at 72 hours post-infection

  • Permeabilizing with 0.5% Triton X-100

  • Performing immunostaining with appropriate antibodies

  • Analyzing using confocal laser scanning microscopy

Is UL1 incorporated into viral particles?

Analysis of highly purified AD169 UL1-HA epitope-tagged virions revealed that pUL1 is a novel constituent of the HCMV envelope . This finding has significant implications for understanding UL1's potential roles in viral entry and host cell interactions. Researchers should employ virion purification techniques followed by immunoblotting to confirm UL1 incorporation in different viral strains.

What role does UL1 play in HCMV infection?

Current evidence suggests that UL1 functions as a cell type-specific tropism factor . The deletion of UL1 in HCMV TB40/E resulted in reduced growth in a cell type-specific manner, indicating that pUL1 may be implicated in regulating HCMV cell tropism . To investigate UL1's role in infection, researchers should:

  • Generate UL1 deletion mutants using homologous recombination in E. coli

  • Confirm correct mutagenesis through restriction pattern analysis, Southern blotting, and PCR

  • Compare growth kinetics across multiple cell types

  • Measure impacts on viral entry, replication, and spread

How does UL1 deletion affect viral growth in different cell types?

An HCMV mutant with a targeted deletion of UL1 exhibits a growth defect phenotype in retinal pigment epithelium cells but not in fibroblasts . This cell type-specific effect suggests that UL1 plays a specialized role in certain cellular contexts. The following table summarizes key observed phenotypes:

Cell TypeWild-type HCMV GrowthΔUL1 HCMV GrowthPhenotypic Effect
Fibroblasts (MRC-5)NormalNormalNo significant effect
Retinal Pigment EpitheliumNormalReducedGrowth defect

This cell type specificity makes UL1 an important target for understanding viral tropism mechanisms and host-pathogen interactions.

How can researchers generate recombinant UL1 constructs for functional studies?

To generate recombinant UL1 constructs, researchers can follow this methodological approach:

  • Design primers containing appropriate restriction sites and epitope tags (e.g., HA tag)

  • Insert the construct into a bacterial artificial chromosome (BAC) containing the HCMV genome through homologous recombination in E. coli

  • Verify the recombinant by restriction enzyme digestion and compare patterns to wild-type virus

  • Confirm proper insertion using Southern blotting with specific probes

  • Remove the kanamycin resistance marker using FLP-mediated recombination

  • Verify final constructs via restriction pattern analysis, Southern blotting, and PCR

  • Reconstitute recombinant HCMV from BAC mutants using Superfect transfection

What techniques are most effective for studying UL1 RNA expression?

For RNA analysis of UL1, Northern blot analysis provides reliable results when performed as follows:

  • Isolate whole-cell RNA from mock-infected or infected cells at different time points (8, 24, 48, and 72 hours post-infection) using QIAshredder columns and an RNeasy minikit

  • Separate 10 μg of each sample by gel electrophoresis on 1% agarose gels containing 2% formaldehyde

  • Perform Northern blot analysis according to standard procedures

  • Use the digoxigenin (DIG) system for hybridization and detection

Additional transcriptomic approaches like RNA-seq can provide more comprehensive insights into UL1 expression in the context of global viral gene expression.

What proteomic approaches are recommended for characterizing UL1?

To characterize UL1 at the protein level, researchers should employ a multi-method approach:

  • Two-dimensional gel electrophoresis (2-DGE) with immobilized pH gradients (IPGs) to separate complex protein mixtures

  • Mass spectrometry (MS) for identification of resolved proteins

  • Peptide mass fingerprinting techniques to match experimentally obtained masses to theoretical peptide masses

  • Tandem MS (MS-MS) for more detailed protein identification and characterization

For uncharacterized proteins like UL1, mass spectrometry-based approaches are particularly valuable for confirming expression, identifying post-translational modifications, and determining protein-protein interactions.

How might UL1's similarity to CEA family proteins influence its function?

The significant similarity between pUL1 and the N-terminal Ig domain of the cellular carcinoembryonic antigen-related (CEA) protein family suggests potential functional parallels . Since the CEA N-terminal domain is responsible for ligand recognition, UL1 may interact with similar cellular receptors or ligands. Advanced researchers should:

  • Identify potential binding partners through co-immunoprecipitation studies

  • Perform site-directed mutagenesis of key residues in the Ig-like domain

  • Conduct binding assays with potential cellular receptors

  • Investigate whether UL1 competes with or mimics CEA family proteins in cellular processes

What are the implications of UL1's localization at virion assembly sites?

The colocalization of pUL1 with TGN-46 and viral structural proteins at the cytoplasmic site of virion assembly and secondary envelopment suggests involvement in virion maturation . Advanced research questions include:

  • Does UL1 interact directly with other viral structural proteins during assembly?

  • What role does UL1 play in the envelopment process?

  • How does UL1 incorporation into virions affect tropism for different cell types?

  • Does UL1 contribute to structural stability or receptor binding capabilities of mature virions?

These questions require sophisticated approaches combining targeted mutagenesis, advanced imaging techniques like super-resolution microscopy, and virion composition analysis.

How does the evolutionary history of UL1 inform current functional studies?

As a gene potentially arising from duplication within the RL11-TRL cluster, UL1 represents an interesting case study in viral gene evolution and specialization . Advanced evolutionary analyses could explore:

  • Selective pressures acting on UL1 compared to its ancestral genes

  • Comparative analysis of amino acid conservation across viral strains

  • Identification of human-specific adaptations in UL1

  • Correlation between UL1 sequence variations and functional differences in clinical isolates

Understanding these evolutionary aspects may provide insights into UL1's role in viral adaptation to human hosts and its potential as a therapeutic target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.