Recombinant Human cytomegalovirus Uncharacterized protein UL6 (UL6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UL6; Uncharacterized protein UL6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Target Names
UL6
Target Protein Sequence
MHAKMNGWAGVRLVTHCLNTRSRTYVALNMLAFARTPRGVPSCLFNKVWVSRYALVLILM VCASESSTSWAVTSNRLPNCSTITTTAGQDAELHGPAPLSCNVTQWGRYENGSTPVLWCT LWGSRTRVSLGHRVAFGCSWKTFFIYNVSESSGGTYYQKGYNCTDKHITLSCFNLTVVPR AVQSTTTVMTPTVVTNSTFSVSLVASRLTTNSSAFRHASYQRQQRVGNGTLSKNITNLAF TYGSWGVAMLLFAAVMVLVDLGLPQSAWRRWRSHVDDEERGLLM
Uniprot No.

Target Background

Protein Families
RL11 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the genomic location and classification of HCMV UL6?

HCMV UL6 is classified as an RL11 gene family member. These genes are located in the RL11 region of the HCMV genome, which contains several genes important for viral latency and reactivation. UL6 belongs to the same genomic region as UL7, which has been previously implicated in latency establishment . To study this gene in experimental settings, researchers typically employ BAC mutagenesis techniques similar to those used for other HCMV genes, creating marker-less mutations using RED-GAM BAC mutagenesis systems. This allows for precise genetic modification without introducing selection markers that might affect adjacent gene expression.

What is currently known about UL6 function in HCMV infection?

Based on available research, UL6 remains largely uncharacterized, but limited data indicates it may interact with cellular proteins involved in hemostasis and cellular proliferation pathways. Specifically, UL6 has been shown to interact with cellular genes QSOX1 and F2, which are involved in controlling cell growth in fibroblasts and blood coagulation, respectively . To investigate UL6 function experimentally, researchers typically generate UL6-null mutant viruses using site-directed mutagenesis to introduce stop codons near the N-terminus of the open reading frame, similar to approaches used for other HCMV genes like UL116 and UL148 .

How does UL6 differ from the better-characterized HSV-1 UL6?

While sharing the same designation, HCMV UL6 differs significantly from its herpes simplex virus (HSV) namesake. HSV-1 UL6 encodes a portal protein that forms the DNA packaging portal in viral capsids, comprising 12 copies arranged in a ring structure through which viral DNA is inserted . In contrast, HCMV UL6 appears to have different functions related to cellular protein interactions and potentially influencing cell proliferation and coagulation pathways . When designing experiments to study HCMV UL6, researchers should be cautious about extrapolating methodologies from HSV-1 UL6 studies due to these functional differences.

What expression systems are suitable for producing recombinant HCMV UL6 protein?

For recombinant expression of HCMV UL6, researchers typically employ mammalian expression systems rather than bacterial systems due to the likely requirement for proper post-translational modifications. Experimentally, this can be achieved using vectors containing CMV promoters transfected into HEK293T or similar cell lines. For co-immunoprecipitation studies investigating protein-protein interactions, epitope tagging strategies (HA, FLAG, or Myc tags) should be carefully considered, as terminal modifications may interfere with protein function. Based on studies of related viral proteins, C-terminal tagging is often preferable to N-terminal modifications to minimize functional disruption .

What are the optimal experimental approaches to investigate UL6 interaction with cellular targets QSOX1 and F2?

To investigate UL6 interactions with QSOX1 and F2, researchers should employ a multi-method approach:

  • Co-immunoprecipitation (Co-IP): Using UL6-specific antibodies or epitope-tagged UL6 constructs, followed by western blotting for QSOX1 and F2.

  • Proximity Ligation Assays (PLA): To visualize protein interactions in intact cells with spatial resolution.

  • CRISPR-Cas9 knockdown: Of cellular targets in HCMV-permissive cells to assess functional relevance.

  • Recombinant virus production: Creating UL6-null mutants using BAC mutagenesis with stop codons introduced near the N-terminus, similar to methods used for UL116 and UL148 studies .

For F2 interaction studies specifically, researchers should include assays for coagulation factor activity in culture supernatants from infected versus uninfected cells to assess functional consequences.

How can researchers distinguish between direct and indirect effects of UL6 on cellular proliferation?

Distinguishing direct from indirect UL6 effects on proliferation requires systematic experimental designs:

  • Inducible expression systems: Using doxycycline-controlled UL6 expression in the absence of other viral proteins.

  • Domain mapping: Creating UL6 truncation mutants to identify specific regions responsible for QSOX1 interaction.

  • Complementation assays: In UL6-null virus, testing whether exogenous QSOX1 expression rescues proliferation phenotypes.

  • Temporal analysis: Carefully tracking QSOX1 activity, cellular proliferation markers, and viral replication kinetics across multiple time points.

  • Transcriptomics: RNA-seq comparing UL6-null versus wild-type virus infections to identify differentially regulated cellular pathways.

When interpreting results, researchers should control for viral load differences that might indirectly affect cellular metabolism rather than reflecting direct UL6 activity.

What strategies should be employed to investigate potential structural motifs within HCMV UL6?

Based on the importance of structural motifs identified in related herpesvirus proteins, researchers should consider:

  • Predictive bioinformatics: Employing tools like PSIPRED and AlphaFold2 to identify potential structural domains, paying particular attention to potential leucine zipper motifs as found important in HSV UL6 .

  • Site-directed mutagenesis: Systematically replacing conserved residues, particularly leucines in predicted alpha-helical regions.

  • Deletion analysis: Creating a series of deletion mutants and testing for retained functionality in complementation assays.

  • Protein tagging strategy optimization: As terminal modifications can disrupt function, researchers should compare N-terminal, C-terminal, and internal tagging approaches to determine which preserves protein functionality .

  • Structural biology approaches: For regions of interest, X-ray crystallography or cryo-EM of recombinant protein fragments can provide definitive structural information.

How can researchers assess UL6 contributions to HCMV latency and reactivation?

To investigate UL6's role in latency and reactivation:

  • Primary cell models: Establish infections in CD34+ hematopoietic progenitor cells or monocytes with wild-type versus UL6-null viruses.

  • Latency markers: Monitor viral transcriptome restricted to latency-associated transcripts in these models.

  • Reactivation stimuli: Compare efficiency of reactivation following differentiation signals or cytokine stimulation.

  • Chromatin immunoprecipitation (ChIP): Assess epigenetic regulation of viral genome in the presence/absence of UL6.

  • Cell-type specific effects: Compare UL6 contributions in different cellular contexts (fibroblasts versus myeloid cells) to identify context-dependent functions.

The analysis should control for initial infection efficiency by normalizing viral genome copies during the establishment of latency.

What are the critical controls needed when studying UL6 in the context of viral replication?

When designing experiments to study UL6 function during HCMV replication, include these essential controls:

  • Complementation controls: Engineer cell lines expressing wild-type UL6 to rescue UL6-null virus phenotypes (similar to CV6 cells for HSV studies) .

  • Revertant viruses: Create revertant viruses where the UL6 mutation is restored to wild-type sequence to confirm phenotypes are specifically due to UL6 disruption.

  • Adjacent gene expression verification: Confirm that manipulating UL6 doesn't affect expression of adjacent genes through RT-qPCR measurement.

  • Protein expression timing: Include time-course western blots to verify that UL6 expression kinetics match expected patterns for its putative function.

  • Multiple viral strains: Test whether UL6 functions are conserved across clinical versus laboratory-adapted HCMV strains.

The timing of UL6 expression relative to other viral genes provides important context for interpreting phenotypes in mutant viruses.

What methodological approaches can address the dominant negative effects observed with mutant viral proteins?

When investigating UL6 function, researchers should be aware of potential dominant negative effects, similar to those observed with certain HSV UL6 mutants :

  • Inducible expression systems: Use tetracycline-regulated promoters to control mutant protein expression levels.

  • Quantitative assessment: Determine the ratio of mutant:wild-type protein that causes inhibitory effects using co-transfection experiments with varying plasmid ratios.

  • Domain isolation: Express specific domains of UL6 to identify which regions mediate dominant negative effects.

  • Heterokaryon assays: Mix cells expressing wild-type and mutant proteins to assess intercellular effects.

  • Cell line engineering: Create stable cell lines expressing varying levels of mutant protein to establish dose-response relationships.

When analyzing dominant negative phenotypes, distinguish between effects on viral assembly versus earlier stages of the viral life cycle through careful temporal analysis.

How should researchers approach UL6 conservation analysis across different HCMV strains?

To effectively analyze UL6 conservation:

  • Sequence alignment pipeline: Include both laboratory strains (AD169, Towne, TB40/E) and clinical isolates in alignments.

  • Structural prediction integration: Map sequence variations onto predicted structural models to identify functionally constrained regions.

  • Selective pressure analysis: Calculate dN/dS ratios to identify regions under positive or purifying selection.

  • Critical domain identification: Focus particularly on regions homologous to amino acids 422-443 in HSV UL6, which contains a functionally important putative leucine zipper motif .

  • Chimeric protein construction: Create chimeric proteins between strains to map functional domains if strain-specific differences in UL6 function are observed.

The conservation analysis should inform the design of mutational studies targeting the most conserved residues, which likely represent functionally critical regions.

What are the best approaches to visualize UL6 localization during different stages of HCMV infection?

For optimal visualization of UL6 localization:

  • Antibody validation: Rigorously validate antibody specificity using UL6-null mutants as negative controls.

  • Super-resolution microscopy: Employ techniques like STORM or STED to resolve subcellular localization beyond diffraction limits.

  • Live-cell imaging: Use split-GFP or HaloTag systems for real-time tracking of UL6 dynamics.

  • Co-localization analysis: Quantify co-localization with cellular markers using Pearson's or Manders' coefficients rather than relying on visual assessment alone.

  • Temporal imaging: Capture images at multiple time points (6, 24, 48, 72, and 96 hours post-infection) to track dynamic changes in localization.

When interpreting localization data, researchers should consider that fixation methods can dramatically affect apparent localization of membrane-associated viral proteins.

What statistical approaches are most appropriate for analyzing potential UL6 effects on viral replication kinetics?

When analyzing replication kinetics data:

  • Growth curve analysis: Employ area-under-curve (AUC) calculations rather than single time-point comparisons.

  • Mixed-effects models: Use these for experiments with repeated measures to account for both fixed effects (virus strain) and random effects (experimental variation).

  • Non-parametric tests: Apply these when data doesn't follow normal distribution, particularly for clinical samples.

  • Multiple comparison correction: Implement Bonferroni or false discovery rate corrections when comparing multiple time points.

  • Power analysis: Conduct a priori power calculations to determine appropriate sample sizes, especially when expected effects are subtle.

For accurate interpretation, viral titers should be measured using multiple methods (plaque assays, TCID50, and qPCR for genome copies) to distinguish between effects on virus production versus infectivity.

How can researchers develop effective detection methods for distinguishing UL6 from other HCMV proteins in complex samples?

Developing specific detection methods for UL6:

  • Epitope mapping: Identify unique epitopes through peptide scanning to generate highly specific antibodies.

  • Mass spectrometry approaches: Employ targeted proteomics with selected reaction monitoring (SRM) to detect specific UL6 peptides in complex samples.

  • Recombinant virus engineering: Create viruses expressing UL6 with small epitope tags or split reporter systems that minimally impact function.

  • Cross-reactivity testing: Validate detection reagents against cell lysates expressing other RL11 family proteins to ensure specificity.

  • Signal amplification methods: Implement proximity extension assays for detection of low-abundance UL6 in clinical samples.

Researchers should explicitly validate that detection methods can distinguish between different UL6 isoforms that might result from alternative splicing or post-translational modifications.

How might UL6-cellular protein interactions be targeted for antiviral therapeutic development?

Based on UL6 interactions with QSOX1 and F2, potential therapeutic approaches include:

  • Peptide inhibitors: Design competitive inhibitors based on interaction domains between UL6 and cellular targets.

  • Small molecule screening: Establish high-throughput screening assays using split-luciferase or FRET-based interaction detection.

  • Structural biology approach: Determine crystal structures of UL6-QSOX1 complexes to enable structure-based drug design.

  • Combination strategies: Test whether UL6-targeting compounds synergize with established anti-HCMV drugs like ganciclovir.

  • Targeted protein degradation: Develop PROTACs (proteolysis targeting chimeras) specifically directing UL6 for degradation.

When assessing therapeutic potential, researchers should determine whether UL6 functions are conserved in clinical isolates and drug-resistant strains to ensure broad applicability of any developed interventions.

What experimental models are most appropriate for studying UL6 contributions to HCMV pathogenesis?

For pathogenesis studies:

  • Humanized mouse models: NOD/SCID/IL2Rγ-null mice reconstituted with human hematopoietic stem cells.

  • Ex vivo tissue models: Human placental explants for congenital infection modeling.

  • Organoid systems: Blood vessel organoids to study UL6 effects on vascular pathology.

  • Primary cell co-culture systems: CD34+ cells with endothelial cells to model viral spread during reactivation.

  • Clinical sample correlation: Compare UL6 sequence variants with disease severity in transplant recipients and congenitally infected infants.

When interpreting pathogenesis data, researchers should account for strain-specific differences in UL6 sequence and expression, as these may contribute to differential virulence observed among clinical isolates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.