Recombinant Human cytomegalovirus Uncharacterized protein UL78 (UL78)

Shipped with Ice Packs
In Stock

Description

Expression Systems and Production

Recombinant UL78 is typically expressed in E. coli systems. Commercial providers (e.g., Creative Biomart, Cusabio) offer it as a lyophilized powder with the following specifications :

ParameterDetails
Expression HostEscherichia coli
TagN-terminal 10xHis tag
Purity>90% (SDS-PAGE verified)
Storage-20°C/-80°C; reconstituted aliquots stable at 4°C for ≤1 week
Sequence CoverageFull-length (1-431 aa; Uniprot ID: P16751)
ApplicationsSDS-PAGE, protein interaction studies, antibody development

Role in Viral Replication

  • Fibroblasts: UL78 is dispensable for replication in fibroblasts, as shown by UL78-deficient HCMV mutants achieving wild-type replication levels .

  • Epithelial/Endothelial Cells: UL78 is critical for efficient viral entry and post-binding nuclear delivery. Deletion mutants exhibit:

    • 5–100-fold reduction in viral titers .

    • Delayed virion DNA delivery to nuclei .

    • Reduced immediate-early (IE1) and early (UL44) protein/RNA expression .

Host-Cell Interactions

  • Chemokine Receptor Modulation: UL78 heteromerizes with human chemokine receptors (e.g., CCR5, CXCR4), impairing their HIV coreceptor activity by altering surface expression and signaling .

  • Intracellular Trafficking: Colocalizes with trans-Golgi network (TGN) markers, suggesting a role in virion assembly or secretion .

Research Applications

Recombinant UL78 is utilized to:

  • Investigate GPCR-mediated viral entry mechanisms .

  • Develop inhibitors targeting HCMV-host interactions .

  • Study UL78’s immunomodulatory effects in co-infections (e.g., HIV) .

Key Research Findings

Study FocusKey ResultsCitation
UL78 Deletion Mutants100-fold replication defect in ARPE19 epithelial cells; no defect in fibroblasts
Protein LocalizationPartial colocalization with TGN46; exclusion from virion assembly compartments
Host Receptor EffectsUL78-CCR5/CXCR4 heteromers reduce HIV coreceptor activity by >50%

Limitations and Future Directions

  • In Vivo Models: The absence of robust HCMV animal models limits pathogenesis studies .

  • Clinical Relevance: UL78’s high conservation among HCMV isolates suggests unexplored roles in latency or immune evasion .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format readily available in our inventory, we understand your specific needs. If you require a particular format, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timelines, kindly consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please communicate this preference in advance; additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we advise brief centrifugation of the vial prior to opening to settle the contents. Reconstitute the protein using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard protocol includes 50% glycerol. Customers can utilize this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and inherent protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is decided during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
UL78; Uncharacterized protein UL78
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-431
Protein Length
full length protein
Species
Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Target Names
UL78
Target Protein Sequence
MSPSVEETTSVTESIMFAIVSFKHMGPFEGYSMSADRAASDLLIGMFGSVSLVNLLTIIG CLWVLRVTRPPVSVMIFTWNLVLSQFFSILATMLSKGIMLRGALNLSLCRLVLFVDDVGL YSTALFFLFLILDRLSAISYGRDLWHHETRENAGVALYAVAFAWVLSIVAAVPTAATGSL DYRWLGCQIPIQYAAVDLTIKMWFLLGAPMIAVLANVVELAYSDRRDHVWSYVGRVCTFY VTCLMLFVPYYCFRVLRGVLQPASAAGTGFGIMDYVELATRTLLTMRLGILPLFIIAFFS REPTKDLDDSFDYLVERCQQSCHGHFVRRLVQALKRAMYSVELAVCYFSTSVRDVAEAVK KSSSRCYADATSAAVVVTTTTSEKATLVEHAEGMASEMCPGTTIDVSAESSSVLCTDGEN TVASDATVTAL
Uniprot No.

Target Background

Gene References Into Functions
  1. Importantly, infection experiments employing a recombinant human cytomegalovirus carrying tagged versions of pUS27 and pUL78 simultaneously revealed that these two proteins do not colocalize during viral infection. PMID: 24517969
  2. UL78 facilitates infection at a stage subsequent to binding but prior to entry in epithelial cells, a cell type crucial for in vivo viral replication and dissemination. PMID: 22915800
  3. UL78 forms oligomers and undergoes trafficking between the plasma membrane and various intracellular compartments. PMID: 22327422
Database Links

KEGG: vg:3077549

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of the UL78 protein?

UL78 is classified as a seven-transmembrane receptor protein encoded by the Human Cytomegalovirus (HCMV). The protein belongs to the G-protein coupled receptor (GPCR) family, specifically as an orphan receptor, meaning its natural ligand(s) have not yet been identified . The protein's seven-transmembrane domains are characteristic of GPCRs, suggesting a potential role in cellular signaling pathways during HCMV infection, although its signaling capabilities remain largely uncharacterized compared to other viral GPCRs .

What is known about UL78's genomic context and transcription within HCMV?

UL78 transcription is activated early after infection and results in a 1.7 kb mRNA . Detailed transcriptional analysis shows that the 5' end of the UL78 mRNA initiates 48 bp upstream of the translation start, and the polyadenylated tail begins 268 bp downstream of the UL78 translation stop codon within the UL79 ORF . Later in the replication cycle, a second mRNA of 4 kb evolves, comprising both the UL77 and UL78 ORFs, suggesting potential coordinated expression of these genes . Inhibition studies demonstrate that UL78 transcription is blocked by cycloheximide but not by phosphonoacetic acid, confirming its classification as an early gene in the context of viral gene expression kinetics .

What methodologies are most effective for studying UL78 localization?

For investigating UL78 localization and trafficking, researchers should employ a combination of approaches. Immunofluorescence microscopy using antibodies against UL78 and markers for various cellular compartments provides spatial information . Surface biotinylation assays can track cell surface expression and internalization rates. For protein-protein interactions, bimolecular fluorescence complementation (BiFC) assays and co-immunoprecipitation are effective techniques . Additionally, subcellular fractionation combined with Western blotting offers biochemical validation of localization findings. For dynamic processes, live-cell imaging with fluorescently tagged UL78 constructs can reveal real-time trafficking patterns.

What is the specific function of UL78 in epithelial and endothelial cells?

In epithelial cells, UL78 is necessary for appropriate delivery of the viral particle to the nucleus . This function appears to be specific to the early stages of infection in these cell types. The mechanism by which UL78 facilitates nuclear delivery remains unclear but may involve interactions with cellular trafficking machinery or cytoskeletal components. This cell type-specific function is particularly significant considering that epithelial and endothelial cells are important targets during in vivo HCMV infection, serving as sites of viral entry, replication, and dissemination.

What genetic engineering approaches are most suitable for studying UL78 function?

Several genetic engineering techniques have proven valuable for UL78 functional studies:

  • Bacterial artificial chromosome (BAC) technology has been successfully used to generate UL78-deficient HCMV, enabling the study of virus replication in the absence of this protein .

  • Site-directed mutagenesis can be employed to modify specific domains of UL78, allowing investigation of structure-function relationships.

  • Fluorescent protein tagging provides a means to visualize UL78 localization and trafficking in live cells.

  • Expression systems in heterologous cells can help assess protein-protein interactions and signaling capabilities isolated from other viral factors.

  • CRISPR-Cas9 genome editing offers possibilities for modifying UL78 in the context of the viral genome with high precision.

When designing such experiments, researchers should consider potential effects of modifications on protein folding, trafficking, and interaction potential.

What cell models are most appropriate for UL78 studies?

The choice of cell model is critical for UL78 research, given its cell type-specific functions:

  • Fibroblasts (e.g., MRC-5, WI-38) represent the traditional model for HCMV studies but may not reveal UL78's critical functions .

  • Epithelial cell lines (e.g., ARPE-19, HEK293) are essential for studying UL78's role in nuclear delivery of viral particles .

  • Endothelial cells (e.g., HUVEC) provide another relevant model where UL78 functions are critical .

  • Ex vivo tissue cultures, such as sections of human renal arteries, offer systems that more closely mimic in vivo conditions .

  • Primary cells isolated from relevant tissues may provide the most physiologically relevant context for UL78 studies.

Each model system has strengths and limitations that should be carefully considered based on the specific research questions being addressed.

What approaches can identify potential UL78 ligands and signaling pathways?

As a putative GPCR, UL78 may engage in ligand binding and cellular signaling. Recommended analytical approaches include:

  • Ligand screening using libraries of chemokines and other potential GPCR ligands, given that other HCMV GPCRs like US28 bind chemokines .

  • Phospholipase C activation assays measuring inositol phosphate accumulation, which has been used successfully with US28 .

  • Calcium flux assays using fluorescent indicators to detect potential signaling events.

  • Phospho-specific antibody-based detection of MAPK pathway activation, as many GPCRs signal through these pathways.

  • Transcriptional reporter assays for downstream response element activation.

  • Proteomics approaches to identify UL78-dependent phosphorylation changes in cellular proteins.

  • Structural biology techniques, including crystallography or cryo-EM, to determine the three-dimensional structure of UL78.

What are the most significant unresolved questions regarding UL78?

Despite progress in characterizing UL78, several critical questions remain:

  • What are the natural ligand(s) for UL78, if any? Unlike US28, which binds multiple C-C chemokines and fractalkine, UL78's ligand binding properties remain unknown .

  • Does UL78 signal through G-proteins or exhibit constitutive activity similar to other viral GPCRs?

  • What is the three-dimensional structure of UL78 and how does it compare to other seven-transmembrane receptors?

  • How does UL78 facilitate nuclear delivery of viral particles in epithelial cells at the molecular level?

  • What host cell factors interact with UL78 during infection?

  • What is the functional significance of UL78's interaction with US28 ?

  • Due to the absence of an in vivo HCMV model, the role of UL78 in the pathogenesis of HCMV infection in humans remains unclear .

Addressing these questions requires interdisciplinary approaches combining virology, structural biology, cell biology, and immunology.

How might UL78 contribute to HCMV pathogenesis?

Based on studies of homologous proteins in rodent CMVs, UL78 may play important roles in viral dissemination and tissue tropism . The cell type-specific requirement of UL78 for replication in epithelial and endothelial cells suggests it may be particularly important for viral spread across epithelial barriers and into the vasculature . UL78's incorporation into the virion particle indicates it might function during the earliest stages of infection, potentially affecting cell tropism or immune evasion . Understanding these potential contributions to pathogenesis is complicated by the strict species specificity of HCMV and the resulting lack of suitable in vivo models.

Table 1: Key Experimental Findings on HCMV UL78

FindingExperimental ApproachCell Type/ModelReference
UL78 transcription activated early after infectionRNA analysis, inhibitor studiesFibroblastsMichel et al., 2005
UL78 results in a 1.7 kb mRNA; second 4kb mRNA with UL77 emerges laterTranscriptional analysisFibroblastsMichel et al., 2005
UL78 deletion does not impair replication in fibroblastsBAC-based gene deletionFibroblastsMichel et al., 2005
UL78 deletion does not reduce virus replication in renal arteriesEx vivo tissue cultureHuman renal artery sectionsMichel et al., 2005
UL78 protein is highly conserved with variations at N and C terminiSequence analysisClinical HCMV isolatesMichel et al., 2005
UL78 mainly associates with endoplasmic reticulumImmunofluorescence microscopyTransfected cellsWagner et al., 2012
UL78 localizes on cell surface and undergoes endocytosisSurface biotinylation, trafficking assaysTransfected cellsWagner et al., 2012
UL78 colocalizes with adaptin and EEA-1Immunofluorescence microscopyTransfected cellsWagner et al., 2012
UL78 forms homomeric and heteromeric structures with US28BiFC assay, co-immunoprecipitationTransfected cellsWagner et al., 2012
UL78 is critical for replication in epithelial and endothelial cellsViral growth analysisEpithelial and endothelial cellsO'Connor and Miller, 2014
UL78 is necessary for appropriate delivery of viral particles to nucleusIntracellular trafficking analysisEpithelial cellsO'Connor and Miller, 2014
UL78 is assembled into mature viral particlesVirion composition analysisPurified virionsO'Connor and Miller, 2014

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.