Recombinant Human cytomegalovirus Uncharacterized protein UL7 (UL7)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Cytomegalovirus Uncharacterized Protein UL7 (UL7)

Human cytomegalovirus (HCMV) is known to have various mechanisms to counteract host immunity . UL7, a protein encoded by HCMV, is a heavily glycosylated transmembrane protein that contains an Ig-like domain showing amino acid similarity to CD229, a cell-surface molecule of the signaling lymphocyte-activation molecule (SLAM) family . The UL7 Ig-like domain resembles the SLAM-family N-terminal Ig-variable domain, which is responsible for homophilic and heterophilic interactions that trigger signaling . UL7 is transcribed with early-late kinetics during the lytic infectious cycle and is constitutively shed from the cell-surface .

Role in Immune Modulation

UL7 expression attenuates the production of proinflammatory cytokines such as TNF, IL-8, and IL-6 in DCs and myeloid cell lines, which may contribute to viral persistence . Deletion of UL8, another protein, or both UL7 and UL8 from the HCMV genome results in an increased production of proinflammatory cytokines during infection of THP-1 cells . Furthermore, UL7 is able to exert its immunomodulatory function during HCMV infection of myeloid cells .

Interaction with Flt-3R and Effects on Hematopoietic Cells

HCMV pUL7 is a ligand for the cytokine receptor Fms-like tyrosine kinase 3 (Flt-3R) . Signaling through the Flt-3R is critical for the normal development of hematopoietic stem and progenitor cells . UL7 protein induces both CD34+ HPC and monocyte differentiation in vitro and in vivo, functioning as a hematopoietic differentiation factor . UL7 mutants fail to reactivate from latency in CD34+ HPCs, although UL7 is non-essential for lytic replication . UL7 signaling via Flt-3R promotes rapid phosphorylation of FOXO3a through the MAPK pathway, resulting in nuclear-to-cytoplasmic translocation and inactivation of the transcription factor .

Involvement in Angiogenesis

Soluble UL7 could be involved in inducing endothelial cell angiogenesis .

UL7 and UL8

When UL7 and UL8 were both removed, there was no impact on the fitness of the virus in human fibroblasts, human microvascular endothelial, or epithelial cell lines .

Data Table: Functional Roles and Characteristics of UL7

FeatureDescriptionReference
Protein TypeHeavily glycosylated transmembrane protein
HomologyShows amino acid similarity to CD229 (SLAM family)
Expression KineticsEarly-late during lytic infection
SecretionConstitutively shed from the cell surface
ImmunomodulationAttenuates production of TNF, IL-8, and IL-6 in dendritic cells and myeloid cell lines
Leukocyte AdhesionMediates adhesion to leukocytes, specifically monocyte-derived DCs
Flt-3R InteractionLigand for Fms-like tyrosine kinase 3 (Flt-3R)
Hematopoietic DifferentiationInduces CD34+ HPC and monocyte differentiation in vitro and in vivo
LatencyUL7 mutants fail to reactivate from latency in CD34+ HPCs
AngiogenesisSoluble UL7 may induce endothelial cell angiogenesis
Genetic ConservationHighly conserved among clinical and lab-adapted HCMV strains (97-100% intragenotype, 83-93% intergenotype)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as per customer preference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
UL7; CEACAM1-like protein UL7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Target Names
UL7
Target Protein Sequence
MASDVSSHLLTVTQSRWTIHHMYNKLLILALFTPVILESIIYVSGPQGGNVTLVSNFTSN ISARWFRWDGNDSHLICFYKRGEGLSTPYVGLSLSCAANQITIFNLTLNDSGRYGAEGFT RSGENETFLWYNLTVKPKPLETTTASNVTTIVTTTPTVIGTKSNVTGNASLAPQLRAVAG FLNQTPRENNTHLALVGVIVFIALIVVCIMGWWKLLCSKPKL
Uniprot No.

Target Background

Function

This protein modulates the host immune response and influences host cytokine production. It exhibits structural and functional homology to host CEACAM1 and induces endothelial cell angiogenesis. As a ligand for the host FLT3 receptor, it activates the PI3K/AKT and MAPK/ERK pathways, thereby triggering hematopoietic progenitor cell and monocyte differentiation, ultimately leading to virus reactivation.

Protein Families
RL11 family
Subcellular Location
Secreted. Host cell membrane; Single-pass membrane protein.

Q&A

What is Human Cytomegalovirus UL7 protein?

Human Cytomegalovirus (HCMV) UL7 is a heavily glycosylated transmembrane protein containing an immunoglobulin-like (Ig-like) domain that exhibits remarkable amino acid similarity to CD229, a cell-surface molecule of the signaling lymphocyte-activation molecule (SLAM) family involved in leukocyte activation . The UL7 Ig-like domain is well-preserved across all HCMV strains and structurally resembles the SLAM-family N-terminal Ig-variable domain responsible for homophilic and heterophilic interactions that trigger signaling . UL7 is transcribed with early-late kinetics during the lytic infectious cycle, making it an important protein to study for understanding HCMV's life cycle and pathogenesis .

What are the genetic characteristics of the UL7 gene in HCMV?

The UL7 gene is part of the RL11 gene family of HCMV and is considered dispensable for lytic viral replication in cell culture . Interestingly, UL7 shares its first exon with another HCMV protein, UL8, indicating genetic economy in the viral genome . The UL7 sequence is highly conserved among clinical and laboratory-adapted HCMV strains, with 97-100% intragenotype conservation and 83-93% intergenotype conservation, suggesting a crucial role in viral replication in the host . This high degree of conservation makes UL7 a potential target for broad-spectrum antiviral strategies against different HCMV strains.

How is UL7 protein processed and secreted from infected cells?

UL7 is a transmembrane glycoprotein that undergoes constitutive shedding from the cell surface through its mucin-like stalk . Research has shown that production of soluble UL7 is enhanced by phorbol 12-myristate 13-acetate (PMA) and reduced by broad-spectrum metalloproteinase inhibitors, indicating regulation through proteolytic processing . For researchers investigating UL7 shedding in experimental systems, it's crucial to consider these factors when designing in vitro studies. Cell culture supernatants should be analyzed for the presence of soluble UL7 using techniques such as Western blotting or ELISA to quantify shedding under different experimental conditions.

How does UL7 protein modulate host inflammatory responses?

UL7 has been demonstrated to attenuate the production of proinflammatory cytokines including TNF, IL-8, and IL-6 in dendritic cells (DCs) and myeloid cell lines . This immunomodulatory function contributes to viral persistence by interfering with cellular proinflammatory responses. Researchers studying this aspect should consider employing cytokine profiling techniques such as multiplex cytokine assays, ELISA, or intracellular cytokine staining followed by flow cytometry. Additionally, transcriptional analysis through qRT-PCR or RNA-seq can provide insights into the molecular mechanisms by which UL7 suppresses proinflammatory gene expression in target cells.

What cell types does UL7 primarily interact with, and what methodologies are best to study these interactions?

UL7 has been shown to specifically mediate adhesion to leukocytes, particularly monocyte-derived dendritic cells (DCs) . While UL7 does not interact with CD229 or other SLAM-family members, it shares their capacity to mediate leukocyte adhesion . To study these interactions, researchers can employ cell adhesion assays using recombinant UL7 protein or UL7-expressing cells and various leukocyte populations. Flow cytometry-based binding assays, microscopy techniques such as confocal or super-resolution microscopy, and surface plasmon resonance can quantitatively assess UL7-cell interactions. Identifying the specific receptors on target cells can be achieved through co-immunoprecipitation followed by mass spectrometry or through targeted receptor blocking experiments.

How does UL7 contribute to HCMV latency in hematopoietic progenitor cells?

UL7 plays a critical role in preventing apoptosis in CD34+ hematopoietic progenitor cells (HPCs), which are a primary site of HCMV latency . Research has shown that UL7, working in concert with viral miRNAs (miR-US5-1 and miR-UL112-3p), protects CD34+ HPCs from apoptosis, thus promoting viral persistence . To study this function, researchers can use adenoviral vectors expressing UL7 to transduce CD34+ HPCs and assess cell survival using flow cytometry-based apoptosis assays such as Annexin V/PI staining. Additionally, knockout or knockdown approaches targeting UL7 in the context of HCMV infection can help determine its specific contribution to HPC survival and viral latency establishment.

What signaling pathways does UL7 activate in host cells?

UL7 functions as a ligand for the cytokine receptor Fms-like tyrosine kinase 3 (Flt-3R), which is critical for normal development of hematopoietic stem and progenitor cells . Upon binding to Flt-3R, UL7 induces activation of the downstream PI3K/AKT and MAPK/ERK signaling pathways . To investigate these signaling effects, researchers should consider employing phospho-specific antibodies in Western blotting or flow cytometry to detect activation of these pathways. Kinase inhibitors targeting PI3K, AKT, or MAPK can help determine the specific contribution of each pathway to UL7-mediated cellular effects. Additionally, gene expression analysis following UL7 treatment can identify downstream transcriptional changes resulting from these signaling events.

What experimental approaches are most effective for producing recombinant UL7 protein for structural and functional studies?

For producing recombinant UL7 protein, researchers should consider several expression systems based on their specific experimental needs. The following table outlines different expression systems and their advantages for UL7 production:

Expression SystemAdvantagesConsiderations for UL7
E. coliHigh yield, cost-effectiveMay lack proper glycosylation; consider expressing only the Ig-like domain
Insect cells (Baculovirus)Post-translational modifications, higher yield than mammalianBetter glycosylation than E. coli, but still not identical to mammalian
Mammalian cells (HEK293, CHO)Native-like glycosylation, proper foldingLower yield, higher cost, but preferred for functional studies
Cell-free systemsRapid production, avoids cell toxicityLimited post-translational modifications

Given UL7's heavily glycosylated nature, mammalian expression systems are generally preferred for functional studies. For structural studies focusing on the Ig-like domain, E. coli expression followed by refolding protocols might be sufficient. Purification strategies should include affinity tags (His, GST, or Fc) for initial capture, followed by size exclusion chromatography to ensure homogeneity of the final product.

How can researchers effectively assess the impact of UL7 on the FOXO3a/BCL2L11 apoptotic pathway?

UL7 affects the phosphorylation status of FOXO3a, which is related to its anti-apoptotic effect in CD34+ HPCs . To study this mechanism, researchers should employ a multi-faceted approach. First, phosphorylation of FOXO3a can be assessed by Western blotting with phospho-specific antibodies or by mass spectrometry-based phosphoproteomics. Second, subcellular localization of FOXO3a (nuclear vs. cytoplasmic) should be determined using immunofluorescence microscopy or subcellular fractionation followed by Western blotting, as phosphorylation typically results in cytoplasmic retention of FOXO3a.

Expression levels of BCL2L11 (BIM), a pro-apoptotic target of FOXO3a, can be quantified using qRT-PCR and Western blotting . The functional impact on apoptosis can be measured through flow cytometry-based assays (Annexin V/PI, TUNEL) or by measuring caspase activation. For comprehensive pathway analysis, researchers should consider chromatin immunoprecipitation (ChIP) to assess FOXO3a binding to the BCL2L11 promoter, as well as reporter gene assays to measure FOXO3a transcriptional activity in the presence or absence of UL7.

What are the most effective strategies for generating UL7-deficient HCMV mutants?

Creating UL7-deficient HCMV mutants requires careful consideration of viral genome editing techniques. The following methodological approaches are recommended:

  • Bacterial Artificial Chromosome (BAC) Recombineering: This is the gold standard for generating HCMV mutants. The viral genome is maintained as a BAC in E. coli, where homologous recombination techniques can be used to delete or modify the UL7 gene. This approach allows for precise genetic manipulation without affecting adjacent genes.

  • CRISPR/Cas9-mediated editing: Recent advances have made it possible to directly edit the HCMV genome using CRISPR/Cas9 systems. This can be particularly useful for introducing point mutations or small deletions in UL7.

  • Markerless mutagenesis: To avoid potential artifacts from selection markers, researchers should consider two-step recombination processes that allow for marker removal, leaving only the desired UL7 modification.

When designing UL7 mutations, researchers should be cautious of potential effects on UL8, which shares its first exon with UL7 . Controls should include revertant viruses to ensure phenotypes are specifically due to UL7 loss. Characterization of mutants should include growth curves in different cell types, particularly those relevant to UL7 function such as CD34+ HPCs and dendritic cells.

How can researchers effectively study the conservation and evolution of UL7 across different HCMV strains?

Given the high conservation of UL7 across HCMV strains (97-100% intragenotype conservation and 83-93% intergenotype conservation) , studying its evolution requires sophisticated approaches. Researchers should:

  • Conduct comprehensive phylogenetic analysis of UL7 sequences from clinical and laboratory-adapted strains. This should include both nucleotide and amino acid sequence analysis, with particular attention to the Ig-like domain and potential functional motifs.

  • Perform selection pressure analysis to identify sites under positive or purifying selection, which may indicate functionally important regions.

  • Use ancestral sequence reconstruction to infer the evolutionary history of UL7 and identify key mutations that may have altered its function over time.

  • Develop chimeric UL7 proteins combining domains from different strains to map strain-specific functional differences.

  • Compare UL7 with homologous proteins in other betaherpesviruses to understand broader evolutionary patterns.

This evolutionary information can provide insights into UL7's essential functions and guide the development of broadly effective antiviral strategies targeting conserved regions.

How does UL7 contribute to HCMV pathogenesis in immunocompromised patients?

HCMV causes serious disease in immunocompromised individuals and is a significant problem during transplantation, with the virus establishing latent infection in CD34+ HPCs and periodically reactivating . UL7's role in this process involves multiple mechanisms:

  • Anti-apoptotic function: UL7 works with viral miRNAs to prevent apoptosis in CD34+ HPCs, promoting viral persistence in these cells .

  • Immunomodulation: UL7 attenuates proinflammatory cytokine production (TNF, IL-8, IL-6) in dendritic cells and myeloid cells, potentially dampening antiviral immune responses .

  • Signaling pathway activation: UL7 binding to Flt-3R activates PI3K/AKT and MAPK/ERK pathways, which may promote survival and proliferation of infected cells .

To study UL7's role in pathogenesis, researchers should consider humanized mouse models where human CD34+ cells can be infected with wild-type or UL7-deficient HCMV. Clinical studies comparing UL7 sequence variants with disease outcomes could also provide valuable insights into its contribution to viral pathogenesis.

What is the potential of UL7 as a target for antiviral therapy or vaccine development?

The high conservation of UL7 across HCMV strains and its multiple roles in viral persistence make it a promising target for therapeutic intervention . Researchers exploring this potential should consider the following approaches:

  • Neutralizing antibodies targeting UL7: Developing monoclonal antibodies that block UL7's interaction with cellular receptors could prevent its immunomodulatory and anti-apoptotic functions.

  • Small molecule inhibitors: High-throughput screening for compounds that disrupt UL7-receptor interactions or interfere with its shedding from infected cells.

  • Vaccine strategies: Including UL7 as an antigen in HCMV vaccine formulations, potentially focusing on the conserved Ig-like domain.

  • Gene therapy approaches: Using CRISPR/Cas9 or similar technologies to target UL7 expression in latently infected cells.

To evaluate these interventions, researchers should assess their impact on viral latency establishment, maintenance, and reactivation in relevant cell types, particularly CD34+ HPCs. Animal models and eventually clinical trials would be necessary to determine efficacy and safety.

What techniques are most appropriate for determining the three-dimensional structure of UL7 protein?

Understanding the three-dimensional structure of UL7, particularly its Ig-like domain, is crucial for elucidating its function and developing targeted therapeutics. Researchers should consider these methodological approaches:

The heavily glycosylated nature of UL7 presents challenges for structural studies. Researchers might consider using glycosylation inhibitors during expression, enzymatic deglycosylation, or expression of minimal functional domains to overcome these challenges.

How can researchers effectively map the functional domains and critical residues of UL7?

Mapping functional domains and critical residues of UL7 requires a systematic approach combining computational prediction with experimental validation:

  • Begin with sequence analysis and structural prediction tools to identify conserved motifs, potential binding interfaces, and structural domains.

  • Generate a panel of UL7 mutants with targeted substitutions or deletions based on these predictions.

  • Assess these mutants using functional assays for:

    • Receptor binding (particularly Flt-3R)

    • Immunomodulatory effects on cytokine production

    • Anti-apoptotic function in CD34+ HPCs

    • Proper folding, glycosylation, and secretion

  • Use alanine scanning mutagenesis to systematically identify critical residues for each function.

  • Employ hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions of UL7 that undergo conformational changes upon receptor binding.

  • Use cross-linking mass spectrometry to map interaction interfaces between UL7 and its binding partners.

These approaches will generate a comprehensive map of structure-function relationships in UL7, guiding both basic research and therapeutic development efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.