Recombinant Human cytomegalovirus Uncharacterized protein UL9 (UL9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
UL9; Uncharacterized protein UL9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-228
Protein Length
Full Length of Mature Protein
Species
Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Target Names
UL9
Target Protein Sequence
FYQWWKPDTTSCIQKTGYEGQNLSLPPSNALSSKDYTFSWYKDSLKALNMLCYYTEKLEE IDSKPDTIRRCFLNHTLFLINLTSHYSGIYYFDSLYTYGWVLRTPLCYNVTVYSIYQTHI HTTILLYPPTSTYNSLTISSFTSTNLTHTAVHYAAGNVEAQHDTATPHTMWIIPLVIVTT IIVLICFKFPQKAWNKFTQYRYNSMLTAA
Uniprot No.

Target Background

Protein Families
HHV-5 UL9 family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is HCMV UL9 and what do we currently know about its function?

UL9 is an uncharacterized protein encoded by the human cytomegalovirus (HCMV), a member of the beta-herpesvirus family. It is classified as part of the RL11 gene family, which encodes known or putative glycoproteins . Current evidence suggests UL9 has unknown function, though deletion mutations of UL9 cause enhanced growth in human foreskin fibroblasts (HFFs) cells . Bioinformatic analyses predict UL9 may function as an immunoglobulin-binding domain, though the sample size in these studies has been limited and its involvement in pathogenesis remains largely speculative .

How does UL9 fit into the genomic organization of HCMV?

UL9 is located in the UL/b' region of the HCMV genome, specifically in a cluster with other proteins including UL10, UL11, UL6, UL7, and UL8 . The gene appears in a genomic region that encodes multiple uncharacterized proteins, many of which have immunomodulatory functions. Sequence analyses across multiple HCMV strains show UL9 is one of the most frequently mutated genes, which may indicate its non-essential nature for viral replication in certain cellular contexts or potential adaptability for immune evasion .

What distinguishes UL9 from other uncharacterized HCMV proteins?

UL9 stands out among uncharacterized HCMV proteins due to its interesting phenotype where deletion appears to enhance viral replication in specific cellular contexts, contrary to many viral genes whose deletion impairs replication . Unlike some other uncharacterized proteins that lack biological significance markers, UL9 appears to have conserved domains suggesting functional importance despite variability across strains. It also belongs to the RL11 family, members of which are frequently pseudogenized in clinical HCMV isolates, suggesting possible roles in host adaptation rather than core viral replication .

What recombinant systems are most effective for studying UL9 function?

The most effective recombinant systems for studying UL9 include:

  • BACmid-derived recombinant HCMV systems: Similar to those used for UL97 studies, where the gene of interest is modified while maintaining the viral backbone . This approach allows for functional analysis in the context of viral infection.

  • Cosmid-based recombination: This method has been employed to create chimeric HCMV strains carrying genomic segments from different HCMV isolates, which can be useful for studying UL9 in different genetic contexts .

  • Expression vectors with epitope tags: For biochemical characterization, expressing UL9 with tags (such as Myc or HA) in mammalian cells allows for protein localization, interaction studies, and functional analyses .

When designing recombinant systems, researchers should consider implementing inducible expression systems to control potential cytotoxic effects and include appropriate controls for potential artifacts introduced by the recombinant expression system.

What cell models are most appropriate for studying UL9 function?

Based on current research on HCMV proteins, the following cell models are most appropriate:

Cell TypeAdvantagesLimitationsApplication for UL9 Studies
Human Foreskin Fibroblasts (HFFs)Support complete HCMV replication; UL9 deletion shows phenotype in these cellsLimited relevance to latencyPrimary choice for replication studies
MRC-5 cellsWell-characterized for HCMV infection; used in quantitative proteomic analysesSimilar limitations to HFFsGood for comparative analysis with other HCMV proteins
CD34+ hematopoietic progenitor cellsModel for HCMV latencyTechnically challengingEssential for studying potential roles in latency
Endothelial cellsModel for chronic infectionDifferent viral gene expression profileUseful for tissue tropism studies
HEK293T cellsEasy transfection for protein expressionNot physiologically relevant for HCMVBiochemical characterization and interaction studies

The choice depends on whether you're studying UL9's role in replication, latency, immune evasion, or protein-protein interactions.

How can I generate and validate a UL9 knockout/mutant HCMV strain?

To generate and validate a UL9 knockout/mutant HCMV strain:

  • Generation methods:

    • BAC recombination technology as demonstrated for other HCMV genes

    • CRISPR-Cas9 genome editing of viral BACs

    • Recombination using overlapping cosmid clones

  • Strategy for UL9 deletion:

    • Replace the UL9 open reading frame with a selectable marker (e.g., kanamycin resistance cassette)

    • Ensure deletion doesn't affect adjacent genes' expression

    • Consider the potential impact on overlapping genes or regulatory elements

  • Validation approaches:

    • PCR verification of genome modification

    • Whole-genome sequencing to confirm deletion and absence of unwanted mutations

    • Transcriptome analysis to verify adjacent gene expression is unaffected

    • Western blotting to confirm protein absence

    • Growth kinetics comparison between wild-type and mutant virus

    • Complementation experiments to confirm phenotype is due to UL9 deletion

How might UL9's role in viral replication be experimentally determined?

To determine UL9's role in viral replication:

  • Comparative replication kinetics analysis:

    • Infect various cell types with wild-type and UL9-deleted viruses at different MOIs

    • Measure viral DNA replication using quantitative PCR at defined intervals (6h, 1d, 3d, 6d, 8d post-infection)

    • Quantify both intracellular and extracellular viral DNA to assess viral genome replication and release

  • Viral progeny production assessment:

    • Collect supernatants from infected cells

    • Perform plaque assays or TCID50 determination

    • Use IE1 staining to quantify infectious units

  • Multi-step growth curve analysis:

    • Infect cells at low MOI (0.1) to observe multiple rounds of infection

    • Monitor growth over 7-10 days to detect subtle phenotypes

  • Single-step growth curve analysis:

    • Infect cells at high MOI (5) to synchronize infection

    • Useful for isolating specific replication steps affected

  • Cell-type dependent analysis:

    • Compare replication in fibroblasts, epithelial cells, and hematopoietic cells

    • May reveal cell-type specific functions of UL9

What potential immunomodulatory functions might UL9 possess and how can they be tested?

Given predictions that UL9 may function as an immunoglobulin-binding domain , potential immunomodulatory functions and testing methods include:

  • Antibody binding and neutralization evasion:

    • Assess whether recombinant UL9 binds human immunoglobulins using immunoprecipitation and surface plasmon resonance

    • Compare neutralization sensitivity of wild-type and UL9-deficient viruses

    • Test if UL9 interferes with antibody-dependent cellular cytotoxicity (ADCC)

  • Complement evasion:

    • Evaluate complement deposition on wild-type versus UL9-mutant virions

    • Measure complement-mediated neutralization efficiency

  • Impact on innate immune signaling:

    • Analyze differential activation of interferon-stimulated genes between wild-type and UL9-deficient virus infection

    • Examine NF-κB and IRF3 signaling pathway modulation

    • Assess differences in innate immune sensor activation (e.g., cGAS-STING, RIG-I)

  • Effects on antigen presentation:

    • Investigate changes in MHC-I and MHC-II surface expression in infected cells

    • Analyze proteasomal degradation of immune-related host proteins

    • Examine T cell recognition of infected cells lacking UL9

  • Cytokine/chemokine modulation:

    • Perform cytokine/chemokine profiling of supernatants from cells infected with wild-type versus UL9-deficient virus

    • Functional validation using recombinant UL9 protein in immune cell activation assays

What is known about UL9's evolutionary conservation across CMV strains and what might this suggest about its function?

Analysis of UL9 across CMV strains reveals:

  • High variability and frequent mutation:

    • UL9 is among the most frequently mutated genes in clinical HCMV isolates

    • It's one of the genes that most commonly becomes a pseudogene during clinical adaptation

  • Strain-specific variations:

    • Different HCMV strains show considerable variation in the UL9 region

    • These variations may reflect adaptation to different host environments or immune pressures

  • Functional implications:

    • The high rate of mutation suggests UL9 is likely non-essential for basic viral replication

    • It may play roles in host-specific adaptation, explaining why deletion enhances replication in fibroblasts

    • The immunoglobulin-binding prediction suggests potential immune evasion functions

  • Evolutionary perspective:

    • As part of the RL11 gene family, UL9 belongs to a group of genes showing high variability across strains

    • This family encodes proteins involved in immune modulation, suggesting UL9 may have similar functions

    • The pattern of evolution suggests selection pressure from host immunity rather than conserved essential functions

This evolutionary pattern is consistent with a role in modulating host-specific immune responses rather than core viral replication functions.

How can protein-protein interaction studies identify UL9 binding partners and potential functions?

To identify UL9 binding partners and potential functions, consider these methodological approaches:

  • Mass spectrometry-based interactome analysis:

    • Express tagged UL9 in infected cells as demonstrated for other HCMV proteins

    • Perform immunoprecipitation followed by mass spectrometry

    • Compare interactome during different phases of infection (immediate-early, early, late)

    • Use SILAC or TMT labeling for quantitative comparison

    • Critical controls include using the tag alone and an irrelevant viral protein

  • Proximity labeling approaches:

    • Fuse UL9 to BioID or APEX2 enzymes for proximity-dependent biotinylation

    • Identify nearby proteins through streptavidin pulldown and mass spectrometry

    • Especially valuable for transient or weak interactions

  • Co-immunoprecipitation validation:

    • Validate key interactions identified in high-throughput screens

    • Use both forward and reverse co-IP for confirmation

    • Include RNase/DNase treatment to exclude nucleic acid-mediated interactions

  • Yeast two-hybrid screening:

    • Screen human cDNA libraries or specific immune component libraries

    • Validate positive hits in mammalian cells

    • Consider membrane-based Y2H systems if UL9 has membrane association

  • Network analysis:

    • Apply "guilt-by-association" algorithms similar to those used for uncharacterized protein function prediction

    • Use PageRank-like algorithms to identify the most relevant biological annotations

    • Integrate with correlation-based approaches using RNA-Seq data

What advanced genetic approaches can be used to study UL9 in the context of HCMV infection?

Several advanced genetic approaches can elucidate UL9 function:

  • Conditional expression systems:

    • Develop an analog-sensitive version of UL9 (if it has enzymatic activity)

    • Create inducible expression systems to control timing of UL9 activity

    • Design degron-tagged UL9 for temporal control of protein levels

  • Transcriptomics and proteomics comparison:

    • Perform RNA-Seq and quantitative proteomics comparing wild-type and UL9-deficient infection

    • Analyze at multiple time points to capture dynamic changes

    • Focus on immune-related pathways given predicted immunomodulatory function

  • Domain mapping through mutagenesis:

    • Generate a panel of UL9 mutants with various domain deletions or point mutations

    • Assess each for ability to restore wild-type phenotype in UL9-deficient virus

    • Map functional domains through complementation assays

  • Recombination-based library screening:

    • Create a library of UL9 variants through error-prone PCR

    • Screen for variants with enhanced or diminished function

    • Use deep sequencing to identify critical residues

  • Synthetic chimeric proteins:

    • Exchange domains between UL9 and homologous proteins from other herpesviruses

    • Test functional conservation across viral species

    • Potential for creating gain-of-function variants

  • Viral genomic approaches:

    • Apply massively parallel reporter assays to study UL9 promoter regulation

    • Use Cas9 screening to identify host factors required for UL9 function

    • Implement viral genetics using recombineering methods established for HCMV

How can structural biology approaches inform understanding of UL9 function?

Structural biology approaches to understand UL9 function include:

How might understanding UL9 function impact HCMV vaccine development?

Understanding UL9 function could impact HCMV vaccine development in several ways:

  • Rational attenuation strategies:

    • If UL9 functions in immune evasion, its deletion could create more immunogenic vaccine strains

    • Since UL9 deletion enhances growth in fibroblasts , this could improve vaccine production efficiency

  • Geographic variation considerations:

    • Given the geographic and multiallelic genetic differences in HCMV , UL9 variants may differ across populations

    • Understanding UL9 variation is crucial as "immunotherapies and drug development targeting CMV that rely on alleles that differ across geographic isolates may now require further investigation as to whether treatment effect will be advantageous to only certain human populations"

  • Antigen design:

    • If UL9 elicits neutralizing antibodies, it could be included in subunit vaccine designs

    • Conversely, if it interferes with protective immunity, its epitopes might be excluded from vaccine formulations

  • Safety assessment:

    • Understanding UL9's role in pathogenesis would inform safety evaluation of live-attenuated vaccines

    • Knowledge of its potential functions in different tissues would help predict possible adverse effects

  • Efficacy markers:

    • Immune responses to UL9 might serve as correlates of protection

    • UL9-specific T cell or antibody responses could be monitored in vaccine trials

What is the potential role of UL9 in HCMV latency and reactivation?

The potential role of UL9 in HCMV latency and reactivation can be explored by:

  • Latency model systems:

    • Compare wild-type and UL9-deficient virus in CD34+ hematopoietic progenitor cell models of latency

    • Assess establishment, maintenance, and reactivation phases

    • Examine UL9 expression during these different phases

  • UL9 regulation of host processes:

    • Investigate whether UL9 modulates host signaling pathways implicated in latency

    • The UL133-UL138 locus has context-dependent functions in different cell types relevant to replication, chronic infection, and latency

    • Determine if UL9 exhibits similar context-dependent functions

  • Mechanistic studies:

    • Analyze UL9 impacts on cell survival, differentiation, and proliferation pathways

    • Investigate potential roles in controlling viral gene expression during latency

    • Examine interactions with key latency-associated viral proteins like UL138

  • Clinical correlations:

    • Study UL9 sequence variations in primary isolates from patients with different reactivation frequencies

    • Analyze UL9 expression in latently infected tissues

    • Compare UL9 antibody levels in patients with controlled versus frequent HCMV reactivation

What methods can determine if UL9 is a potential target for antiviral development?

To assess UL9 as a potential antiviral target:

  • Druggability assessment:

    • Perform computational analysis of UL9 structure for potential binding pockets

    • Screen fragment libraries for binding to purified UL9

    • Identify allosteric sites that might regulate function

  • Function-based screening:

    • Develop high-throughput assays measuring UL9's predicted function

    • Screen compound libraries for inhibitors

    • Validate hits in viral replication assays

  • Phenotypic screening approaches:

    • Compare compound efficacy between wild-type and UL9-deficient viruses

    • Identify compounds that lose activity against UL9-deficient virus

    • Confirm direct targeting through resistance mutations mapping to UL9

  • Genetic validation:

    • Determine whether UL9 is essential for viral replication in relevant cell types

    • Since UL9 deletion enhances replication in fibroblasts , assess cell-type specific effects

    • Evaluate whether compensatory mechanisms emerge upon UL9 inhibition

  • Target validation criteria:

    • Conservation across clinical isolates

    • Non-redundant function (not easily compensated by other viral or host factors)

    • Amenable to small molecule inhibition

    • Activity in relevant models of HCMV disease

How does UL9 compare to functionally characterized proteins in other herpesviruses?

While UL9 in HCMV remains largely uncharacterized, comparative analysis with other herpesvirus proteins reveals:

  • Nomenclature distinctions:

    • The UL9 designation in HCMV should not be confused with HSV-1 UL9, which functions as an origin-binding protein essential for DNA replication

    • HCMV UL9 belongs to the RL11 family, which has no direct homologs in alpha or gamma herpesviruses

  • Functional homology with other viral immunomodulators:

    • If UL9 indeed functions as an immunoglobulin-binding protein , it would be functionally similar to:

      • HSV-1 gE/gI complex (Fc receptor)

      • HCMV UL119-UL118 (viral Fcγ receptor)

      • EBV BARF1 (soluble CSF-1 receptor)

  • Evolutionary considerations:

    • UL9 is part of the RL11 family genes that are unique to betaherpesviruses

    • Unlike conserved genes involved in DNA replication (UL54, UL44, UL57), UL9 likely evolved for species-specific host adaptation

    • The frequent pseudogenization of UL9 mimics patterns seen in other non-essential immunomodulatory genes

  • Structural homology predictions:

    • Immunoglobulin-binding domains occur across multiple virus families

    • Structural rather than sequence homology may reveal functional relationships to proteins in other viruses

What can we learn from comparing UL9 across different HCMV strains and clinical isolates?

Comparing UL9 across HCMV strains and clinical isolates reveals:

  • Sequence variation patterns:

    • UL9 is one of the most frequently mutated genes in clinical HCMV isolates

    • Along with RL5A, UL1, and RL6 (members of the RL11 family), UL9 is among the most commonly pseudogenized genes

  • Geographic distribution:

    • HCMV shows significant geographic and multiallelic genetic differences

    • Reference strains like Towne (79% African genetic composition) differ from AD169 and Merlin (primarily European)

    • These differences may extend to UL9 function and could impact host-pathogen interactions in different populations

  • Clinical correlations:

    • Examining UL9 sequences from different patient groups (congenital infections, transplant recipients, AIDS patients)

    • Correlating UL9 variants with viral compartmentalization, tropism, or disease severity

    • Analyzing transmission patterns of specific UL9 variants

  • Functional implications:

    • The high mutation rate suggests UL9 is under selective pressure

    • Different variants may optimize for specific host environments or immune pressures

    • Laboratory adaptation often leads to mutation or deletion, suggesting in vitro growth selection

What experimental challenges are specific to studying uncharacterized proteins like UL9 in large DNA viruses?

Studying uncharacterized proteins like UL9 in large DNA viruses presents unique challenges:

  • Genome complexity and gene overlaps:

    • HCMV has approximately 236 kb genome encoding >170 genes

    • Genes may overlap in different reading frames, complicating mutagenesis

    • When making UL9 mutations, researchers must ensure they don't affect overlapping genes or regulatory elements

  • Viral adaptation during propagation:

    • HCMV rapidly adapts to cell culture, potentially mutating uncharacterized genes

    • UL9 is among genes frequently mutated during laboratory passage

    • Need for low-passage clinical isolates or cloned BACs derived directly from clinical material

  • Cell type-specific effects:

    • Functions may only be apparent in specific cell types relevant to in vivo infection

    • UL9 deletion enhances growth in fibroblasts but effects in other cell types remain unknown

    • Need for physiologically relevant cell models beyond fibroblasts

  • Temporal regulation challenges:

    • Expression timing may be critical for function

    • Need for time-course experiments covering immediate-early, early, and late phases

    • Protein may function differently during lytic versus latent infection

  • Technical limitations:

    • Large genome size complicates recombinant virus production

    • Slow replication kinetics extends experimental timelines

    • Limited availability of tools compared to model viruses

    • Need for complementing cell lines when studying essential genes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.