Recombinant Human DC-STAMP domain-containing protein 1 (DCST1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please specify it, and we will prioritize its inclusion in the manufacturing process.
Synonyms
DCST1; E3 ubiquitin-protein ligase DCST1; DC-STAMP domain-containing protein 1; RING-type E3 ubiquitin transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-706
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
DCST1
Target Protein Sequence
MDIKHHQNGTRGQRRKQPHTTVQRLLTWGLPVSCSWFLWRQPGEFPVTALLLGAGAGGLL AIGLFQLLVNPMNIYEEQKIMFLYSLVGLGAMGWGTSPHIRCASLLLVPKMLGKEGRLFV LGYALAAIYVGPVANLRHNLNNVIASLGCTVELQINNTRAAWRISTAPLRAMFKDLLSSK ELLRAETRNISATFEDLDAQVNSETGYTPEDTMDSGETAQGREARQAPASRLHLSTQKMY ELKTKLRCSYVVNQAILSCRRWFDRKHEQCMKHIWVPLLTHLLCLPMKFKFFCGIAKVME VWCRNRIPVEGNFGQTYDSLNQSIRGLDGEFSANIDFKEEKQAGVLGLNTSWERVSTEVR DYVYRQEARLEWALGLLHVLLSCTFLLVLHASFSYMDSYNHDIRFDNIYISTYFCQIDDR RKKLGKRTLLPLRKAEEKTVIFPCKPTIQASEMSNVVRELLETLPILLLLVVLCGLDWAL YSIFDTIRHHSFLQYSFRSSHKLEVKVGGDSMLARLLRKTIGALNTSSETVMESNNMPCL PQPVGLDARAYWRAAVPIGLLVCLCLLQAFGYRLRRVIAAFYFPKREKKRILFLYNDLLK KRAAFTKLRRAAILRRERQQKAPRHPLADILHRGCPLLRRWLCRRCVVCQAPETPESYVC RTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG
Uniprot No.

Target Background

Function
DCST1 acts as an E3 ubiquitin-protein ligase. It mediates 'Lys-48'-linked ubiquitination of STAT2, leading to its proteosomal degradation. This process ultimately negatively regulates type-I-interferon signaling.
Gene References Into Functions
  1. DCST1 regulates Type I interferon signaling by interacting with and promoting ubiquitination-mediated degradation of STAT2, a crucial component in antiviral gene induction. PMID: 27782195
Database Links

HGNC: 26539

KEGG: hsa:149095

UniGene: Hs.567717

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is DCST1 and what are its known isoforms?

DCST1, also known as DC-STAMP domain-containing protein 1, is a transmembrane protein that exists in three distinct isoforms weighing 80.7 kDa, 75.7 kDa, and 77.7 kDa. The protein is involved in processing and displaying antigens for immune responses and plays a critical role in sperm-egg fusion during fertilization. DCST1 belongs to a family of evolutionarily conserved proteins found across species ranging from humans to invertebrates such as nematodes and fruit flies .

How is DCST1 evolutionarily conserved across species?

DCST1 demonstrates remarkable evolutionary conservation, serving as the mammalian orthologue of Caenorhabditis elegans spermatogenesis-defective 49 (SPE-49) and Drosophila SNEAKY. Phylogenetic analysis reveals that DCST1 and its paralogue DCST2 belong to different clades, with DCST2 appearing to be more closely related to ancestral molecules. This suggests that DCST1 likely arose after branching from DCST2 during evolutionary development. The conservation of these proteins across such diverse species (spanning nearly one billion years of evolution) highlights their fundamental importance in reproductive biology across the animal kingdom .

What is the genomic organization of DCST1 and its relationship to DCST2?

The genomic arrangement of DCST1 and DCST2 is notable for their head-to-head configuration. These genes are transcribed in opposite directions, facing each other on the chromosome. This arrangement suggests potential co-regulation of these paralogues. In experimental studies, researchers have successfully disrupted both genes simultaneously by replacing DCST1 exons 1-3 and DCST2 exons 1-4 (including the promoter region) with a neomycin-resistance gene during embryonic stem cell manipulation .

What antibodies and reagents are available for DCST1 research?

Several commercial antibodies are available for DCST1 research applications. These include:

Catalog NumberAntibody TypeApplicationsReactivityDetails
H00149095-M04MonoclonalELISAHumanMouse IgG2a Kappa Monoclonal Clone #2C12
H00149095-Q01-WB, ELISA, MA, AP--
NBP2-31817PolyclonalIHCHumanRabbit IgG Polyclonal

These antibodies allow for multiple detection methods including enzyme-linked immunosorbent assay (ELISA), Western blotting (WB), immunohistochemistry (IHC), microarray (MA), and antibody pairs (AP), providing researchers with versatile tools for studying DCST1 expression and localization .

What are recommended methods for generating DCST1 knockout models?

Based on published research, successful DCST1 knockout models have been generated using homologous recombination in embryonic stem cells. For DCST1/DCST2 double knockout models, researchers replaced DCST1 exons 1-3 and DCST2 exons 1-4 (including the promoter region) with a neomycin-resistance gene. For more targeted approaches, CRISPR/Cas9 technology has been successfully employed using guide RNAs with the following sequences:

  • For DCST1: 5'-CACCGGGAGACTCGCCAGGCGGATC-3' and 5'-AAACGATCCGCCTGGCGAGTCTCCC-3'

  • For DCST2: 5'-CACCGGCATGAAGTTGTACACTGCC-3' and 5'-AAACGGCAGTGTACAACTTCATGCC-3'

These guide sequences can be annealed and cloned into appropriate CRISPR vectors for the generation of gene-edited cell lines or animal models .

How can DCST1 expression be validated at the mRNA level?

For RT-PCR validation of DCST1 expression, the following primer pair has been successfully used:

  • Forward primer: 5'-CTCATCAACACTTCACAGCCTAGGG-3'

  • Reverse primer: 5'-GGAGACTCGCCAGGCGGATC-3'

RNA extraction should be performed using high-quality reagents such as NucleoSpin RNA Plus or equivalent, followed by treatment with rDNase. First-strand cDNA synthesis can be performed using a PrimeScript II 1st strand cDNA Synthesis Kit with Oligo(dT)15 primers. PCR amplification can be carried out using TaKaRa Ex Taq Hot Start Version or similar high-fidelity polymerases. β-actin (Forward: 5'-TGACAGGATGCAGAAGGAGA-3', Reverse: 5'-GCTGGAAGGTGGACAGTGAG-3') serves as an appropriate housekeeping gene for normalization of expression levels .

How does DCST1 contribute to the molecular machinery of gamete fusion?

The precise molecular mechanism remains under investigation, but current evidence suggests that DCST1/2 works in coordination with other sperm fusion factors such as IZUMO1 and SPACA6. Intriguingly, DCST1/2 appears to regulate the protein stability of SPACA6, possibly through DCST1's ubiquitin ligase activity. This suggests a complex regulatory network where DCST1/2 may influence gamete fusion both directly and through modulation of other fusion-related factors .

What is the relationship between DCST1, IZUMO1, and SPACA6 during fertilization?

A complex interrelationship exists between DCST1, IZUMO1, and SPACA6 during fertilization. Western blot analyses of knockout models have revealed that:

  • In DCST1/2-deficient sperm, SPACA6 protein is absent while IZUMO1 remains present

  • In IZUMO1-deficient sperm, SPACA6 protein is also absent

  • When IZUMO1 is reintroduced into IZUMO1-deficient sperm via transgenic rescue (IZUMO1-/-IZUMO1-TG), SPACA6 protein reappears

  • Interestingly, when DCST1/2 is reintroduced into DCST1/2-deficient sperm (DCST1/2-/-DCST1/2-TG), fertility is restored even though SPACA6 protein remains absent

These findings suggest that IZUMO1 and SPACA6 are cooperative factors, with IZUMO1 influencing SPACA6 stability. Meanwhile, DCST1/2 appears to operate through both SPACA6-dependent and SPACA6-independent mechanisms during fertilization. This suggests multiple regulatory pathways governing gamete fusion, with DCST1/2 potentially representing an evolutionarily ancient mechanism that has been supplemented with additional factors like IZUMO1 and SPACA6 in mammals .

How does DCST1's ubiquitin ligase activity influence sperm protein dynamics?

DCST1 possesses ubiquitin ligase activity, which likely plays a significant role in regulating protein stability during spermatogenesis. The experimental evidence shows that SPACA6 protein is absent in mature DCST1/2-deficient spermatozoa, suggesting that DCST1/2 may regulate the stability of SPACA6 through ubiquitin-mediated processes.

Interestingly, even when DCST1/2 is reintroduced through transgenic rescue, SPACA6 protein does not reappear, yet fertility is restored. This suggests that precise temporal expression of proteins during native spermatogenesis, potentially regulated by DCST1's ubiquitin ligase activity, is critical for normal SPACA6 protein stability. The transgenic rescue, which expresses DCST1/2 under possibly different timing or levels, may bypass the need for SPACA6 through alternative mechanisms or may engage with residual amounts of SPACA6 that are below detection thresholds but functionally sufficient .

What controls should be included when studying DCST1 in fertilization assays?

When designing fertilization assays to study DCST1 function, the following controls should be included:

What transgenic approaches are recommended for DCST1 complementation studies?

For DCST1 complementation studies, two successful approaches have been documented:

  • Full genomic rescue: For DCST1, researchers have successfully used a 17.5 kb DNA fragment containing the whole DCST1 gene, digested with NotI and SalI from a bacterial artificial chromosome (BAC) DNA clone (RP24-185C5). This approach preserves the native regulatory elements and genomic context.

  • Promoter-driven expression: For DCST2, researchers designed a PA-tagged DCST2 construct inserted between the Calmegin promoter (a testis-specific promoter) and a rabbit β-globin polyadenylation signal. This approach allows for tissue-specific expression.

For transgene detection, the following PCR primer sets have been used successfully:

  • DCST1-TG specific: 5'-GGCCGCTCTAGAACTAGTGGAT-3' and 5'-GGTGTTTGTGTTACTGAAGTCACTG-3'

  • DCST2-TG specific: 5'-CCTTCCTGCGGCTTGTTCTCT-3' and 5'-GGCTATGTGTTTCACGGCAT-3'

These transgenic approaches provide complementary strategies for rescue experiments, allowing researchers to distinguish between effects caused by gene absence versus protein dysfunction .

How should researchers address apparent contradictions in SPACA6 stability results?

The unexpected finding that fertility can be restored in DCST1/2-deficient mice through transgenic rescue (DCST1/2-/-DCST1/2-TG) without restoring detectable SPACA6 protein presents an interpretive challenge. Researchers should consider:

  • Threshold effects: SPACA6 may be present below Western blot detection thresholds but at levels sufficient for function.

  • Alternative pathways: DCST1/2 may activate redundant pathways that can compensate for SPACA6 absence.

  • Temporal regulation: The transgenic expression of DCST1/2 may occur at different developmental timepoints than endogenous expression, potentially bypassing regulatory steps that normally involve SPACA6.

  • Protein interactions: DCST1/2 may directly substitute for some SPACA6 functions through protein-protein interactions not present in complete knockout models.

To address these possibilities, researchers should employ more sensitive detection methods (such as mass spectrometry), conduct co-immunoprecipitation studies to identify protein-protein interactions, and develop inducible expression systems to control the timing of DCST1/2 expression during spermatogenesis .

What statistical approaches are appropriate for analyzing DCST1-related fertilization data?

For statistical analysis of DCST1-related fertilization data, researchers have successfully employed the OriginPro software package. When comparing fertilization rates, motility, or other quantitative parameters between wild-type and knockout models, data should be presented as mean ± standard error of the mean (s.e.m.).

For sperm motility assessments, computer-assisted sperm motility analysis systems such as CEROS have been used to obtain objective measurements. Sample sizes should be adequately large; published studies have successfully used measurements from approximately 1400-1500 spermatozoa from six individuals per group. This approach provides sufficient statistical power while controlling for individual variation.

When analyzing binary outcomes (such as fertilized versus unfertilized eggs), appropriate statistical tests include chi-square or Fisher's exact test. For continuous variables, t-tests or ANOVA with appropriate post-hoc tests should be employed depending on the number of groups being compared .

What are the promising avenues for translational research involving DCST1?

Given DCST1's critical role in fertilization and its evolutionary conservation, several promising research directions emerge:

  • Male contraceptive development: As DCST1/2-deficient males are infertile but otherwise healthy, these proteins represent potential targets for non-hormonal male contraceptives. Researchers should consider high-throughput screening for small molecule inhibitors of DCST1 function or protein-protein interactions.

  • Fertility diagnostics: Evaluating DCST1 expression or function in human sperm may provide insights into unexplained male infertility cases. Developing clinical assays to assess DCST1 status could enhance diagnostic capabilities.

  • Assisted reproduction technology: Understanding the molecular details of DCST1 function could lead to improved in vitro fertilization techniques, particularly in cases where conventional methods fail due to fusion defects.

  • Comparative biology applications: The conservation of DCST1 across species offers opportunities to study fundamental mechanisms of membrane fusion that may have applications beyond reproduction .

What techniques would advance our understanding of DCST1's protein structure-function relationship?

Future research into DCST1 structure-function relationships would benefit from:

  • Cryo-electron microscopy: To determine the three-dimensional structure of DCST1 alone and in complex with interaction partners.

  • Site-directed mutagenesis: Systematic mutation of key domains, particularly the DC-STAMP domain and potential ubiquitin ligase regions, to identify critical functional residues.

  • Domain swapping experiments: Creating chimeric proteins between DCST1 orthologs from different species to identify evolutionary conserved functional domains.

  • Proximity labeling techniques: BioID or APEX2-based approaches to identify the DCST1 interactome during different stages of spermatogenesis and fertilization.

  • Super-resolution microscopy: To precisely localize DCST1 during the fertilization process and visualize its dynamic redistribution during the acrosome reaction and gamete fusion .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.