Recombinant Human DDB1- and CUL4-associated factor 17 (DCAF17)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill requests to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DCAF17; C2orf37; DDB1- and CUL4-associated factor 17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-520
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
DCAF17
Target Protein Sequence
MGPTRKPNVCSRLSRRALGCFSRDAGVVQRTNLGILRALVCQESTKFKNVWTTHSRSPIA YERGRIYFDNYRRCVSSVASEPRKLYEMPKCSKSEKIEDALLWECPVGDILPNSSDYKSS LIALTAHNWLLRISATTGKILEKIYLAPYCKFRYLSWDTPQEVIAVKSAQNRGSAVARQA GIQQHVLLYLAVFRVLPFSLVGILEINKKIFGNVTDATLSHGILIVMYSSGLVRLYSFQT IAEQFMQQKLDLGCACRWGGTTGTVGEAPFGIPCNIKITDMPPLLFEVSSLENAFQIGGH PWHYIVTPNKKKQKGVFHICALKDNSLAKNGIQEMDCCSLESDWIYFHPDASGRIIHVGP NQVKVLKLTEIENNSSQHQISEDFVILANRENHKNENVLTVTASGRVVKKSFNLLDDDPE QETFKIVDYEDELDLLSVVAVTQIDAEGKAHLDFHCNEYGTLLKSIPLVESWDVTYSHEV YFDRDLVLHIEQKPNRVFSCYVYQMICDTGEEEETINRSC
Uniprot No.

Target Background

Function

May function as a substrate receptor for the CUL4-DDB1 E3 ubiquitin-protein ligase complex.

Gene References Into Functions
Gene References and Associated Functions
  1. The phenotypic variability of Woodhouse-Sakati syndrome due to the c.436delC founder DCAF17 mutation may be more extensive than previously understood. PMID: 29574468
  2. This highlights the crucial, yet under-researched role of DCAF17 in both the development and maintenance of adult tissue homeostasis. PMID: 26612766
  3. Reports two novel frameshift mutations in C2orf37, found in a compound heterozygous state in an Indian family with Woodhouse-Sakati syndrome. PMID: 26440089
  4. Direct sequencing of the C2orf37 gene revealed a homozygous c.436delC (p.Ala147Hisfs*9) mutation in affected siblings and a heterozygous state in parents and a healthy sister. PMID: 24015686
  5. This study demonstrates that DCAF17 mutations cause deafness-dystonia syndrome. PMID: 23418071
  6. A Pakistani family with Woodhouse-Sakati syndrome; DNA sequencing revealed a novel splice site mutation (c.321 + 1 G > A) in the C2orf37 gene, located on chromosome 2q22.3-2q35. PMID: 21963443
  7. Mutations in C2orf37 are causative for Woodhouse-Sakati syndrome. PMID: 21964978
  8. Reports the first Italian cases of Woodhouse-Sakati syndrome caused by a novel C2orf37 mutation. PMID: 21044051
  9. Examines the C2orf37 mutational spectrum in Woodhouse-Sakati syndrome patients. PMID: 20507343
  10. Mutations in C2orf37, which encodes a nucleolar protein, cause a syndrome characterized by hypogonadism, alopecia, diabetes mellitus, intellectual disability, and extrapyramidal symptoms. PMID: 19026396
Database Links

HGNC: 25784

OMIM: 241080

KEGG: hsa:80067

STRING: 9606.ENSP00000364404

UniGene: Hs.659439

Involvement In Disease
Woodhouse-Sakati syndrome (WoSaS)
Subcellular Location
Membrane; Multi-pass membrane protein. Nucleus, nucleolus. Note=According to PubMed:19026396, it is a nucleolar protein, while sequence analysis programs clearly predict 2 transmembrane regions.
Tissue Specificity
Ubiquitously expressed.

Q&A

What is the structure and function of DCAF17 protein?

DCAF17 is a nucleolar protein that functions as a substrate co-receptor for the Cul4-DDB1 ubiquitin ligase complex. The gene encodes two isoforms: alpha (453 amino acids; NP_001158293.1) and beta (520 amino acids; NP_079276.2). The protein is expressed in multiple tissues including brain, liver, skin, and notably in the seminiferous tubules of male mice .

Within cells, DCAF17 localizes to the nucleolus, suggesting potential roles in:

  • Substrate recognition for the ubiquitin-proteasome pathway

  • Ribosome biogenesis and nucleolar function

  • Regulation of cell cycle and cellular aging

Though its precise function remains under investigation, DCAF17 is essential for proper gonadal development, particularly spermatogenesis, as demonstrated in knockout mouse models . Mutations in DCAF17 cause Woodhouse-Sakati syndrome, a rare autosomal recessive disorder characterized by hypogonadism, alopecia, diabetes, intellectual disability, and progressive extrapyramidal symptoms .

How is DCAF17 expression regulated across different tissues?

DCAF17 shows tissue-specific expression patterns that correlate with its biological functions:

TissueExpression LevelNotes
TestisHighestGradual increase during post-natal development
BrainModerateRelevant to neurological symptoms in WSS
LiverModerateMay relate to metabolic functions
SkinModerateCorresponds to alopecia in WSS patients

Expression profiling performed by quantitative RT-PCR demonstrates that DCAF17 mRNA levels in testis increase progressively with age during postnatal development, suggesting developmental regulation . This correlates with the timing of spermatogenesis and male reproductive development.

The high expression in testis is particularly significant, as Dcaf17 knockout mice show male infertility while female fertility remains unaffected. Histological examination of Dcaf17-/- testis reveals impaired spermatogenesis with vacuoles and sloughed cells in the seminiferous tubules .

Methods to study DCAF17 expression include:

  • Quantitative RT-PCR for transcript analysis

  • Western blotting using specific antibodies

  • Immunohistochemistry for tissue localization

  • RNA-Seq for transcriptome-wide expression profiling

What experimental approaches can be used to study DCAF17 function in mammalian cells?

Several established techniques can effectively investigate DCAF17 function:

Expression Systems

  • Transient transfection with tagged DCAF17 constructs (e.g., Myc-DDK-tagged DCAF17 in pCMV6-Entry vector)

  • Stable cell lines with inducible expression

  • Viral transduction for difficult-to-transfect cells

Loss-of-Function Studies

  • siRNA/shRNA-mediated knockdown (70% knockdown of DCAF17 reduced degradation of DNA Ligase I in response to serum starvation)

  • CRISPR-Cas9 genome editing to create complete knockout

  • Dominant-negative mutant expression

Protein Interaction Studies

  • Co-immunoprecipitation with potential partners

  • Pulldown experiments with purified proteins (DCAF17 binds specifically to nickel beads liganded by His-tagged DNA Ligase I)

  • Proximity labeling methods (BioID, APEX)

Functional Assays

  • In vitro ubiquitylation assays:

    • Immunoprecipitate Cul4 complex from cells

    • Add recombinant DCAF17, E1 enzyme, E2 enzymes, and biotinylated ubiquitin

    • Add substrate (e.g., DNA Ligase I)

    • Analyze by Western blot for ubiquitylated products

  • Protein stability measurements with cycloheximide chase

  • Nucleolar localization and function assessment

  • Cell cycle analysis and proliferation assays

These approaches have revealed that DCAF17 directly interacts with and targets DNA Ligase I for ubiquitylation by the Cul4-DDB1 E3 ligase complex, especially during serum starvation .

What is the role of DCAF17 in the ubiquitin-proteasome pathway?

DCAF17 functions as a substrate receptor within the Cul4-DDB1 E3 ubiquitin ligase complex:

  • Structural Organization: DCAF17 binds to DDB1, forming part of the substrate recognition module of the Cul4-DDB1 complex.

  • Functional Mechanism: As demonstrated in biochemical studies, DCAF17:

    • Recognizes specific substrate proteins (e.g., DNA Ligase I)

    • Recruits them to the Cul4-DDB1 complex for ubiquitylation

    • Facilitates their subsequent degradation by the 26S proteasome

  • Regulation: The interaction between DCAF17 and its substrates can be regulated by:

    • Cell proliferation status (increased association with DNA Ligase I in serum-starved cells)

    • Post-translational modifications

    • Cellular localization (nucleolar compartmentalization)

Experimental evidence for DCAF17's role includes:

  • Co-immunoprecipitation showing DCAF17 interaction with Cul4-DDB1 complex

  • Enhanced ubiquitylation of DNA Ligase I when recombinant DCAF17 is added to Cul4 immunoprecipitates

  • Reduced degradation of DNA Ligase I after DCAF17 knockdown

This function in protein turnover likely explains the diverse phenotypes observed in Woodhouse-Sakati syndrome, as DCAF17 mutations would lead to dysregulated levels of critical substrate proteins in affected tissues.

What animal models are available for studying DCAF17 function?

The primary animal model for DCAF17 research is the Dcaf17 knockout mouse, which has provided valuable insights into protein function:

Dcaf17 Knockout Mouse Characteristics:

  • Generation Method: Gene targeting to disrupt the Dcaf17 gene

  • Fertility Phenotype:

    • Male mice: Infertile

    • Female mice: Normal fertility

  • Sperm Parameters:

    • Significantly reduced sperm count

    • Abnormal sperm morphology

    • Severely reduced motility

Histological Findings:

  • Impaired spermatogenesis with vacuoles in seminiferous tubules

  • Presence of sloughed cells in tubule lumens

  • Asymmetric acrosome capping

  • Impaired nuclear compaction

  • Abnormal round spermatid to elongated spermatid transition

These findings demonstrate that DCAF17 is essential for normal sperm development, particularly during spermiogenesis (the transformation of round spermatids into elongated spermatozoa).

Advanced animal models in development include:

  • Conditional knockout models using Cre-loxP technology

  • Knock-in models with specific patient mutations

  • Humanized mouse models expressing human DCAF17 variants

These models are invaluable for understanding the tissue-specific requirements for DCAF17 and the mechanisms underlying Woodhouse-Sakati syndrome.

How do mutations in DCAF17 lead to Woodhouse-Sakati syndrome?

Woodhouse-Sakati syndrome (WSS) is caused by biallelic pathogenic variants in DCAF17. The mechanisms linking these mutations to the diverse clinical manifestations include:

Types of Pathogenic DCAF17 Mutations:

  • Nonsense mutations: c.906G>A (p.Ser114Term), c387G>A (p.Trp302Term), c341C>A (p.Trp129Term)

  • Frameshift mutations: c.1111delA (p.Ile371Term), c.1488_1489delAG

  • Splice site mutations: Affecting intron-exon boundaries

Molecular Consequences:

  • Truncated Protein Production: Most mutations result in premature termination codons, leading to:

    • Unstable protein products

    • Missing domains required for DDB1-CUL4 interaction

    • Loss of substrate recognition capability

  • Nucleolar Disruption: DCAF17 mutations disrupt nucleolar function, affecting:

    • Ribosome biogenesis

    • Cell cycle regulation

    • RNA processing

    • Cellular aging pathways

  • Aberrant Protein Homeostasis: Dysfunction in the ubiquitin-proteasome pathway leads to:

    • Accumulation of unregulated substrate proteins

    • Compromised cellular quality control mechanisms

    • Tissue-specific protein imbalances

Clinical correlation shows that white matter lesions are observed in approximately 69.2% of WSS patients with confirmed DCAF17 mutations, linking the gene to proper white matter development or maintenance .

What methods are available for genetic testing and diagnosis of DCAF17-related disorders?

Several validated methodologies are used for DCAF17 genetic testing:

Sequencing Approaches:

  • Exome Sequencing with CNV Detection:

    • Provides full coverage of all coding exons plus 10 bases of flanking non-coding DNA

    • Can detect copy number variations

    • Typical coverage: >20X NGS reads

  • Sanger Sequencing:

    • Used for confirmation of variants identified by NGS

    • Standard method for orthogonal validation

    • Particularly useful for STAT turnaround times

  • Whole Genome Sequencing:

    • Allows detection of non-coding and regulatory variants

    • Can identify structural variations that may affect DCAF17 expression

Performance Metrics for Blueprint Genetics Assay:

Variant TypeHeteroplasmy LevelSensitivitySpecificity
SNVs45-100%100.0%100.0%
SNVs35-45%100.0%100.0%
SNVs25-35%100.0%100.0%
SNVs15-25%100.0%100.0%
Indels 1-10bp45-100%100.0%100.0%
Indels 1-10bp5-45%100.0%100.0%
Data from analytic validation studies

Validation Methodology:

  • Forward primer: 3′-CAGAATCTCCGAATTTGAAGGAG-5′

  • Reverse primer: 3′-TCTTTAAATCTGAAATGTACATGGG-5′

  • Sequencing depth: 200×

  • Target coverage: 99.57%

These genetic testing approaches have successfully identified novel DCAF17 variants in patients from diverse ethnic backgrounds, including previously unreported cases in Chinese populations .

What are the challenges in producing recombinant DCAF17 protein for research applications?

Producing functional recombinant DCAF17 presents several technical challenges:

Expression System Selection:

  • Bacterial systems: Limited by lack of proper folding machinery and post-translational modifications

  • Insect cell systems: Better for complex protein folding but lower yield

  • Mammalian expression: Most physiologically relevant but typically lower yields and higher cost

Available Commercial Options:

  • DCAF17 (Myc-DDK-tagged) Human expression clone (RC228367) available in pCMV6-Entry vector

  • Features kanamycin resistance for E. coli selection and neomycin resistance for mammalian cell selection

Protein Characteristics Affecting Production:

  • Nucleolar localization may require specific targeting sequences

  • Potential for aggregation due to hydrophobic regions

  • Need for proper folding to maintain interaction surfaces for DDB1-CUL4 binding

Optimization Strategies:

  • Solubility Enhancement:

    • Fusion tags (MBP, GST, SUMO)

    • Co-expression with chaperones

    • Optimization of buffer conditions

  • Functional Validation:

    • In vitro binding assays with DDB1

    • Ubiquitylation activity tests with known substrates

    • Comparison with native protein from cell lysates

  • Co-expression Approaches:

    • Co-expression with DDB1 and/or CUL4

    • Reconstitution of minimal functional complexes

For analytical applications, successful protocols have included immunoprecipitating the Cul4 complex from cells and adding recombinant DCAF17 to enhance substrate ubiquitylation in vitro .

How can CRISPR-Cas9 technology be applied to study DCAF17 function?

CRISPR-Cas9 technology offers powerful approaches for investigating DCAF17:

Genome Editing Applications:

  • Complete Gene Knockout:

    • Design sgRNAs targeting early exons of DCAF17

    • Create frameshift mutations or large deletions

    • Analyze resulting phenotypes compared to Dcaf17 knockout mouse models

  • Patient Mutation Knock-in:

    • Introduce specific mutations identified in Woodhouse-Sakati syndrome patients

    • c.1111delA (p.Ile371Term) or c.1488_1489delAG frameshift variants

    • Study molecular consequences and potential therapeutic approaches

  • Tagging Endogenous DCAF17:

    • Knock-in fluorescent reporters (GFP, mCherry) to track expression and localization

    • Add affinity tags (FLAG, HA) for improved immunoprecipitation and interaction studies

    • Create fusion proteins for proximity labeling (BioID, APEX)

  • Conditional Systems:

    • Generate floxed alleles for tissue-specific deletion

    • Create inducible knockout systems for temporal control

    • Develop degron-tagged versions for rapid protein depletion

Validation and Analysis Methods:

  • Genotyping by PCR and sequencing

  • Western blotting to confirm protein loss or modification

  • Functional assays focusing on:

    • Ubiquitylation activity

    • Protein-protein interactions

    • Nucleolar structure and function

    • Cell type-specific phenotypes

CRISPR approaches have distinct advantages over RNAi, as demonstrated in studies showing that 70% knockdown of DCAF17 by shRNA reduced degradation of DNA Ligase I but did not completely abolish function .

What role does DCAF17 play in nucleolar function and how does this relate to disease pathogenesis?

DCAF17 localizes to the nucleolus and contributes to multiple nucleolar functions:

Nucleolar Processes Potentially Regulated by DCAF17:

  • Ribosome Biogenesis:

    • Potential regulation of rRNA processing

    • Quality control of ribosomal proteins

    • Assembly of pre-ribosomal particles

  • Cell Cycle Regulation:

    • Nucleolar stress response coordination

    • Control of cell proliferation through substrate degradation

  • RNA Processing:

    • Small-RNA processing

    • mRNA transport mechanisms

    • Signal recognition pathways

Disease Mechanisms Related to Nucleolar Dysfunction:

DCAF17 mutations disrupt nucleolar homeostasis, potentially leading to:

Disrupted ProcessClinical Manifestation
Ribosome biogenesisGlobal growth abnormalities
Protein synthesisTissue-specific developmental defects
Cellular agingProgressive nature of symptoms
Nucleolar stress responseWhite matter lesions (observed in 69.2% of WSS patients)

Supporting Evidence:

Mutation of DCAF17 leads to disruption of the nucleolus, affecting:

  • Dysregulated ribosome biogenesis

  • Cell cycle abnormalities

  • Premature cellular aging

  • Altered RNA metabolism

These mechanisms likely contribute to the progressive and multi-systemic nature of Woodhouse-Sakati syndrome, with tissues requiring high protein synthesis rates (such as neural tissue, endocrine organs, and hair follicles) being particularly vulnerable to disruptions in nucleolar function.

What molecular mechanisms explain the spermatogenesis defects in DCAF17-deficient models?

Studies of Dcaf17 knockout mice have revealed specific mechanisms underlying male infertility:

Spermatogenesis Abnormalities:

  • Structural Defects:

    • Asymmetric acrosome capping

    • Impaired nuclear compaction

    • Abnormal transition from round to elongated spermatids

  • Cellular Consequences:

    • Formation of vacuoles in seminiferous tubules

    • Presence of sloughed cells in tubule lumens

    • Production of sperm with abnormal morphology and drastically reduced motility

Molecular Basis:

The ubiquitin-proteasome system plays crucial roles during spermatogenesis, particularly in:

  • Removing excess cytoplasm during spermatid elongation

  • Regulating histone-protamine exchange for nuclear compaction

  • Controlling acrosome formation and sperm head shaping

As a substrate receptor for the Cul4-DDB1 E3 ubiquitin ligase complex, DCAF17 likely regulates the turnover of key proteins during these processes. When DCAF17 is absent, these proteins accumulate inappropriately, disrupting the precisely coordinated events of spermiogenesis.

Expression Pattern Correlation:

  • DCAF17 shows highest expression in testis

  • Expression increases during postnatal development

  • Timing correlates with the onset of spermatogenesis

This specific role in male reproductive development explains why Dcaf17 knockout mice show male infertility while female fertility remains unaffected, despite the multi-system nature of Woodhouse-Sakati syndrome in humans.

How do different DCAF17 mutations affect protein function and disease severity?

Different DCAF17 mutations have varying impacts on protein structure and function:

Mutation Types and Consequences:

Mutation TypeExampleMolecular EffectFunctional Impact
Nonsensec.906G>A (p.Ser114Term)Early truncationComplete loss of function
Frameshiftc.1111delA (p.Ile371Term)Truncated protein missing key domainsLoss of substrate recognition capability
Splice siteIntronic variantsExon skipping or intron retentionAberrant protein structure
Deletionc.1488_1489delAGFrameshift leading to premature terminationTranslation of truncated functionless protein

Structural and Functional Analysis:

  • Domain Disruption:

    • N-terminal truncations: Loss of DDB1 binding domains

    • C-terminal truncations: Loss of substrate recognition regions

    • Internal disruptions: Altered protein folding and stability

  • Cellular Consequences:

    • Mislocalization from the nucleolus

    • Inability to interact with the Cul4-DDB1 complex

    • Failure to recruit substrate proteins for ubiquitylation

  • Disease Severity Correlation:
    While genotype-phenotype correlations are still being established, evidence suggests:

    • Complete loss-of-function mutations typically cause the full spectrum of WSS symptoms

    • Different mutations may affect specific tissues to varying degrees

    • White matter lesions are observed in approximately 69.2% of WSS patients regardless of mutation type

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.