Recombinant Human Diacylglycerol O-acyltransferase 2-like protein 6 (DGAT2L6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If a particular tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
DGAT2L6; DC3; Diacylglycerol O-acyltransferase 2-like protein 6; Diacylglycerol O-acyltransferase candidate 3; hDC3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
DGAT2L6
Target Protein Sequence
MAFFSRLNLQEGLQTFFVLQWIPVYIFLGAIPILLIPYFLLFSKFWPLAVLSLAWLTYDW NTHSQGGRRSAWVRNWTLWKYFRNYFPVKLVKTHDLSPKHNYIIANHPHGILSFGVFINF ATEATGIARIFPSITPFVGTLERIFWIPIVREYVMSMGVCPVSSSALKYLLTQKGSGNAV VIVVGGAAEALLCRPGASTLFLKQRKGFVKMALQTGAYLVPSYSFGENEVFNQETFPEGT WLRLFQKTFQDTFKKILGLNFCTFHGRGFTRGSWGFLPFNRPITTVVGEPLPIPRIKRPN QKTVDKYHALYISALRKLFDQHKVEYGLPETQELTIT
Uniprot No.

Target Background

Function
Recombinant Human Diacylglycerol O-acyltransferase 2-like protein 6 (DGAT2L6) is a diglyceride acyltransferase utilizing fatty acyl-CoA as a substrate. It exhibits high activity with oleate as a substrate and lacks wax synthase activity for wax ester production. This protein can utilize 1-monoalkylglycerol (1-MAkG) as an acyl acceptor, synthesizing monoalkyl-monoacylglycerol (MAMAG).
Database Links

HGNC: 23250

OMIM: 300926

KEGG: hsa:347516

STRING: 9606.ENSP00000328036

UniGene: Hs.454355

Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in all tissues tested except pancreas.

Q&A

What is the genomic location and structure of DGAT2L6?

DGAT2L6 is located on the X chromosome in humans. Based on comparative genomic analysis with other species like buffalo, DGAT2L6 is part of a group of X-chromosome linear genes, which in buffalo are located within the 80.20-80.40 Mb region . The gene has a specific accession number (NM_198512.3) and NCBI Gene ID (347516) .

The genomic structure of DGAT2L6 positions it as part of the DGAT2 subfamily, which includes other members like DGAT2, DGAT2L1, DGAT2L3, DGAT2L4, DGAT2L5, and DGAT2L7. These genes distribute across different chromosomes, with DGAT2L6 being specifically an X-chromosome linked gene alongside DGAT2L3 and DGAT2L4 .

How does DGAT2L6 relate functionally to other DGAT family members?

DGAT2L6 belongs to the DGAT2 subfamily of enzymes that play crucial roles in triacylglycerol biosynthesis. While the DGAT family includes four distinct functional subfamilies (DGAT1, DGAT2, DGAT3, and WAX-DGAT), only DGAT1 and DGAT2 enzymes have been detected in animals, with each playing non-redundant roles in triacylglycerides synthesis .

The DGAT2 subfamily, which includes DGAT2L6, contains members that are high-priority candidate genes for quantitative traits related to dietary fat uptake and triglyceride synthesis and storage in animals. Research has demonstrated that other members of this family, like DGAT2, have associations with milk production traits in various species . While specific functions of DGAT2L6 are still being elucidated, its membership in this gene family suggests involvement in lipid metabolism pathways.

What are the known protein domains and motifs in DGAT2L6?

DGAT2L6 encodes a diacylglycerol O-acyltransferase 2-like protein that contains characteristic domains of the DGAT2 family. While the search results don't provide specific domain information for DGAT2L6, it likely shares structural features with other DGAT2 family members. These typically include transmembrane domains, a neutral lipid-binding domain, and a highly conserved HPHG motif essential for catalytic activity.

The protein likely functions at the endoplasmic reticulum membrane where it catalyzes the final and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl-CoA as substrates. Further structural studies using techniques like X-ray crystallography or cryo-electron microscopy would be valuable for fully characterizing DGAT2L6's structural elements.

What are the optimal conditions for expressing recombinant DGAT2L6 in mammalian cells?

For optimal expression of recombinant DGAT2L6 in mammalian cells, researchers should consider several methodological approaches:

  • Vector Selection: Lentiviral vectors are recommended for DGAT2L6 expression due to their relatively high transduction efficiency and ability to integrate into the genome. As noted in the search results, "Lentiviruses can integrate into the genome with relatively high transduction efficiency and they are very useful for cells that have low transfection efficiency with other transfection reagents" .

  • Cell Line Selection: HEK293T cells are commonly used for initial expression studies as demonstrated by the availability of DGAT2L6 CRISPR Knockout 293T Cell Line . Alternative cell lines derived from tissues with high lipid metabolism activity (hepatocytes, adipocytes) may be relevant for functional studies.

  • Expression Conditions: For optimal expression, consider:

    • Temperature: 37°C is standard, but reduced temperatures (30-33°C) may improve proper folding

    • Duration: Observe expression from 48 hours up to 5 days after infection

    • Media supplements: Addition of fatty acids may support enzyme activity analysis

  • Verification Methods: Confirm successful expression using:

    • Western blotting with anti-DGAT2L6 antibodies

    • qPCR to quantify mRNA expression

    • Enzymatic activity assays measuring triacylglycerol formation

How can CRISPR-Cas9 gene editing be used to study DGAT2L6 function?

CRISPR-Cas9 technology offers powerful approaches for studying DGAT2L6 function:

  • Knockout Studies: Complete gene knockout can reveal the phenotypic consequences of DGAT2L6 loss. Commercial knockout cell lines, like the DGAT2L6 CRISPR Knockout 293T Cell Line, provide ready-to-use systems validated by "Screen It™ CRISPR Cas9 Cleavage Detection Kit and Sanger sequencing" .

  • sgRNA Design Considerations:

    • Target unique regions of DGAT2L6 to avoid off-target effects on other DGAT family members

    • Design multiple sgRNAs targeting different exons

    • Validate sgRNA efficiency using cleavage detection assays

  • Functional Assays Post-Knockout:

    • Lipid profiling using mass spectrometry

    • Triacylglycerol synthesis rate measurement

    • Cellular phenotype analysis (lipid droplet formation, membrane composition)

  • Rescue Experiments:

    • Re-introduce wild-type or mutant DGAT2L6 to knockout cells

    • Use inducible expression systems to control timing and level of rescue

    • Compare functional restoration across different variants

When designing CRISPR experiments, researchers should carefully validate genomic modifications through Sanger sequencing to confirm the presence of indels .

What approaches can be used to investigate DGAT2L6 polymorphisms and their association with metabolic traits?

Investigating DGAT2L6 polymorphisms and their association with metabolic traits requires a multi-faceted approach:

  • Polymorphism Identification:

    • Whole-genome or targeted sequencing of DGAT2L6 in diverse populations

    • SNP array analysis focusing on the X-chromosome region containing DGAT2L6

    • Analysis of existing genomic databases for previously identified variants

  • Association Studies:

    • Case-control studies comparing polymorphism frequencies between groups with different metabolic profiles

    • Quantitative trait analysis examining the relationship between variants and continuous metabolic measures

    • Haplotype block construction and analysis, similar to approaches used for other DGAT family members

  • Functional Validation:

    • In vitro enzymatic activity assays of variant proteins

    • Cell-based assays measuring lipid synthesis and accumulation

    • Animal models expressing human DGAT2L6 variants

  • Data Analysis Framework:

    • Apply least square mean (LSM) analysis to evaluate phenotypic effects of different haplotypes

    • Adjust for covariates including age, sex, and environmental factors

    • Consider X-chromosome specific statistical approaches due to DGAT2L6's location

Based on approaches used with related genes, researchers could build haplotype blocks and perform association analyses with metabolic traits such as serum lipid levels, body fat distribution, or insulin sensitivity .

What are the recommended methods for measuring DGAT2L6 enzymatic activity?

Measuring DGAT2L6 enzymatic activity requires careful experimental design:

  • In vitro Assays:

    • Substrate Preparation: Use purified diacylglycerol and radioactively labeled acyl-CoA (e.g., [14C]oleoyl-CoA)

    • Reaction Conditions: Buffer at pH 7.4, containing magnesium and manganese ions, incubated at 37°C

    • Product Detection: Thin-layer chromatography followed by autoradiography or scintillation counting

  • Cell-based Assays:

    • Lipid Droplet Formation: Stain cells with Oil Red O or BODIPY dyes

    • Radiometric Assays: Feed cells radioactive fatty acids and measure incorporation into triglycerides

    • Mass Spectrometry: Analyze cellular lipid profiles with liquid chromatography-mass spectrometry

  • Control Experiments:

    • Include DGAT2L6 knockout cells as negative controls

    • Compare activity with other DGAT family enzymes

    • Test inhibitor specificity across DGAT family members

  • Data Analysis:

    • Calculate enzyme kinetics parameters (Km, Vmax)

    • Determine substrate preferences through competition assays

    • Compare activity across different cellular compartments

ParameterRecommended ConditionNotes
pH7.2-7.5May require optimization for DGAT2L6
Temperature37°CPhysiological temperature
Diacylglycerol Concentration50-200 μMTitrate to determine optimal range
Acyl-CoA Concentration10-50 μMOften limiting substrate
Reaction Time5-30 minutesEnsure linearity of reaction
Detection MethodTLC or LC-MS/MSMS provides greater specificity

How can DGAT2L6 expression patterns be analyzed across different tissues and developmental stages?

Comprehensive analysis of DGAT2L6 expression patterns requires multiple complementary techniques:

  • Transcriptomic Analysis:

    • RNA-Seq: Provides quantitative data on mRNA expression across tissues

    • Single-cell RNA-Seq: Resolves cell type-specific expression patterns

    • qRT-PCR: Targeted validation of expression in specific tissues

    • Developmental Time Course: Analyzing expression across embryonic and postnatal stages

  • Protein-level Analysis:

    • Western Blotting: Quantification of protein levels across tissues

    • Immunohistochemistry: Cellular and subcellular localization in tissue sections

    • Proteomics: Mass spectrometry-based quantification

  • Reporter Systems:

    • DGAT2L6 Promoter-Reporter Constructs: Drive fluorescent protein or luciferase expression

    • Knock-in Reporter Animals: Tag endogenous DGAT2L6 with fluorescent protein

  • Data Integration:

    • Compare expression patterns with other DGAT family members

    • Correlate with lipid metabolic activity across tissues

    • Map temporal expression to developmental milestones

Since DGAT2L6 is an X-chromosome gene , researchers should also consider sex-specific expression patterns and potential X-inactivation effects when analyzing expression data.

How can researchers distinguish the functional effects of DGAT2L6 from other DGAT family members?

Distinguishing the specific functions of DGAT2L6 from other DGAT family members requires strategic experimental approaches:

  • Gene-specific Perturbation:

    • CRISPR Knockout: Generate single and combinatorial knockouts of DGAT family members

    • siRNA/shRNA: Use carefully validated sequences with minimal off-target effects

    • Specific Inhibitors: Develop or apply inhibitors with selectivity for DGAT2L6

  • Rescue Experiments:

    • Complementation Analysis: Express individual DGAT genes in cells with multiple DGAT knockouts

    • Domain Swapping: Create chimeric proteins to map functional domains

    • Site-directed Mutagenesis: Target catalytic residues to create inactive enzymes

  • Substrate Specificity Analysis:

    • Compare DGAT2L6 with other family members for preference toward different:

      • Acyl-CoA chain lengths and saturations

      • Diacylglycerol species

      • Reaction conditions (pH, ionic strength)

  • Evolutionary and Comparative Genomics:

    • Analyze syntenic regions across species

    • Evaluate evolutionary conservation of DGAT2L6

    • Compare chromosomal localization (X-chromosome for DGAT2L6)

To systematically compare DGAT family members, researchers might construct a table like this:

FeatureDGAT1DGAT2DGAT2L6Other DGAT2 Family Members
Chromosome LocationBBU15/BTA14 BBU16/BTA15 X Chromosome Various
Substrate PreferenceBroaderMore specificTo be determinedVaries
Tissue ExpressionWidespreadLipid-active tissuesTo be determinedVaries
Knockout PhenotypeViable, reduced milk fatLethal in miceTo be determinedVaries
Associated TraitsMilk fat percentage Milk yield, protein content To be determinedVarious

What bioinformatic approaches are most useful for analyzing DGAT2L6 in genomic and transcriptomic datasets?

Bioinformatic analysis of DGAT2L6 requires specialized approaches considering its genomic context:

  • Sequence Analysis:

    • Comparative Genomics: Align DGAT2L6 across species to identify conserved regions

    • Motif Identification: Detect functional domains and regulatory elements

    • Variant Annotation: Assess impact of SNPs and other variants on protein function

    • X-chromosome Specific Analysis: Account for hemizygosity in males and X-inactivation

  • Expression Analysis:

    • Co-expression Networks: Identify genes with similar expression patterns

    • Differential Expression: Compare across tissues, conditions, and disease states

    • Splice Variant Analysis: Identify and characterize alternative transcripts

    • Single-cell Transcriptomics: Resolve cell type-specific expression patterns

  • Functional Prediction:

    • Protein Structure Modeling: Predict 3D structure using homology to other DGAT family members

    • Molecular Dynamics Simulations: Model substrate binding and catalytic activity

    • Pathway Analysis: Map DGAT2L6 in lipid metabolism networks

    • Protein-Protein Interaction: Predict functional partners

  • Integration with Genomic Data:

    • eQTL Analysis: Correlate genetic variants with expression levels

    • GWAS Integration: Connect DGAT2L6 variants to phenotypic traits

    • Haplotype Analysis: Construct haplotype blocks as demonstrated for other DGAT genes

    • Synteny Analysis: Compare genomic context across species

When analyzing DGAT2L6 in comparative genomic studies, researchers should be attentive to its X-chromosome location. As noted for buffalo and cattle, linear genes on the X-chromosome including DGAT2L3, DGAT2L4, and DGAT2L6 have specific relative positions that can be compared across species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.