Recombinant Human Diacylglycerol O-acyltransferase 2 (DGAT2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DGAT2; HMFN1045; UNQ738/PRO1433; Diacylglycerol O-acyltransferase 2; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diglyceride acyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
DGAT2
Target Protein Sequence
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLN RSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKG GRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATE VSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGG AAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQ KKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHT MYMEALVKLFDKHKTKFGLPETEVLEVN
Uniprot No.

Target Background

Function
Diacylglycerol O-acyltransferase 2 (DGAT2) is an essential acyltransferase catalyzing the final and committed step in triacylglycerol (TAG) synthesis. It utilizes diacylglycerol and fatty acyl-CoA as substrates. DGAT2 is crucial for intracellular triglyceride synthesis and storage, playing a central role in cytosolic lipid accumulation. In the liver, it primarily incorporates endogenously synthesized fatty acids into triglycerides. It also functions as an acyl-CoA retinol acyltransferase (ARAT) and can utilize 1-monoalkylglycerol (1-MAkG) as an acyl acceptor for monoalkyl-monoacylglycerol (MAMAG) synthesis.
Gene References Into Functions
  1. DGAT2 possesses a C-terminal signal sequence mediating interaction with lipid droplets. PMID: 29902571
  2. A study identified patients with congenital diarrheal disorders and DGAT1 mutations, resulting in reduced protein expression. Fibroblasts and intestinal organoids from these patients exhibited altered lipid metabolism and susceptibility to lipid-induced cell death. Wildtype DGAT1 or DGAT2 expression restored normal lipid metabolism. PMID: 29604290
  3. Loss-of-function mutations in DGAT2 and FAAH were reported in an obese individual, potentially interacting to influence adiposity, suggesting a model for genetic interaction in human obesity. PMID: 28243972
  4. This research identified prostate cancer death-predisposing SNPs (rs143975731, rs12277366, rs2155225, and rs2155222) as DGAT2 regulators in prostate tumors. PMID: 27113481
  5. A novel de novo p.Y223H mutation in DGAT2 was identified in a Korean Charcot-Marie-Tooth (CMT) family, suggesting it as a cause of autosomal-dominant CMT2. PMID: 26786738
  6. uPA/uPAR stimulates triglyceride synthesis in Huh7 hepatoma cells via p38-dependent upregulation of DGAT2. PMID: 25244504
  7. DGAT2 is regulated by gp78-associated endoplasmic reticulum-associated degradation (ERAD) post-translationally. PMID: 24820123
  8. This study examined hepatic triacylglycerol synthesis and secretion, highlighting DGAT2's role linking glycemia and triglyceridemia. PMID: 23489367
  9. This research describes distinct yet synergistic roles of DGAT1 and DGAT2 in TAG synthesis and secretion, with DGAT2 acting upstream of DGAT1. PMID: 22748069
  10. Niacin treatment might reduce liver fat content in Chinese patients with dyslipidemia, potentially through DGAT2 inhibition. PMID: 22315393
  11. DGAT2 expression is reduced in psoriatic skin. PMID: 14521909
  12. Niacin selectively inhibited DGAT2 activity but not DGAT1, without affecting DGAT1 and DGAT2 mRNA expression. PMID: 15258194
  13. This study found no significant role for common genetic variation in DGAT2 in obesity development. PMID: 17477860
  14. Diacylglycerol acyltransferase 2 expression is regulated by C/EBPbeta and C/EBPalpha during adipogenesis. PMID: 17504763
  15. Overexpressing human DGAT2 in mouse glycolytic muscle promoted insulin resistance, potentially contributing to diabetes. PMID: 17940217
  16. This review summarizes DGAT1 and DGAT2, focusing on advancements since gene cloning, including their roles in human health and disease. PMID: 18757836
  17. The ER-resident transmembrane DGAT2 is also found in mitochondria-associated membranes, where its N-terminus may facilitate mitochondrial association. PMID: 19049983
Database Links

HGNC: 16940

OMIM: 606983

KEGG: hsa:84649

STRING: 9606.ENSP00000228027

UniGene: Hs.129798

Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lipid droplet. Cytoplasm, perinuclear region.
Tissue Specificity
Predominantly expressed in liver and white adipose tissue. Expressed at lower level in mammary gland, testis and peripheral blood leukocytes. Expressed in sebaceous glands of normal skin but decreased psoriatic skin.

Q&A

What is the primary function of DGAT2 in human lipid metabolism?

DGAT2 is one of two enzymes that catalyzes the final and only committed step in triacylglycerol (TAG) synthesis. Specifically, DGAT2 catalyzes the reaction in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs to form triglycerides. This reaction is crucial for energy storage in the form of lipid droplets within cells. DGAT2 functions optimally at low concentrations of magnesium chloride, which distinguishes it from DGAT1 that exhibits high activity at elevated magnesium chloride concentrations . Studies in murine models have demonstrated that DGAT2 is responsible for the majority of TAG synthesis in mammalian systems, as DGAT2 knockout mice showed almost no TAG content and died shortly after birth, while DGAT1-deficient mice remained viable with only modest reductions in tissue TG content .

How is the DGAT2 gene structured and where is it located in the human genome?

The human DGAT2 gene is located on chromosome 11. The gene encodes multiple transcript variants that result in different isoforms of the DGAT2 protein . These transcript variations contribute to the functional diversity of DGAT2 across different tissues and under different physiological conditions. The gene contains both coding regions (exons) and non-coding regions (introns), with most reported mutations occurring within intronic regions, substitution/missense mutations, and synonymous mutations .

What are the key structural domains of DGAT2 and how do they relate to function?

DGAT2 is a transmembrane protein with two predicted transmembrane domains that are critical for its localization and function. Research has identified specific regions that are essential for:

  • Enzyme catalytic activity: The catalytic site contains conserved residues, with mutations in this region often showing high pathogenicity scores in disease contexts .

  • Protein-protein interactions: DGAT2 forms multimeric complexes through interactions between individual DGAT2 subunits. Both N-terminal and C-terminal domains mediate these subunit interactions .

  • Subcellular localization: The first transmembrane domain (TMD1) contains the ER targeting signal, which is essential for proper localization. Without its transmembrane domains, DGAT2 relocates from the ER to mitochondria .

  • Lipid droplet association: DGAT2 has the ability to associate with lipid droplets even when not localized to the ER, suggesting independent lipid droplet targeting mechanisms .

How do DGAT1 and DGAT2 differ in their contribution to triglyceride synthesis?

Despite catalyzing the same chemical reaction, DGAT1 and DGAT2 play distinct roles in triglyceride metabolism:

CharacteristicDGAT1DGAT2
Impact on TG synthesisModest contributionMajor contributor
Knockout phenotypeViable mice with modest TG reductionLethal with almost no TG present
Overexpression effectModerate increase in intracellular TGLarge increase in intracellular TG
Mg²⁺ requirementHigh activity at high Mg²⁺ concentrationsActive at low Mg²⁺ concentrations
Subcellular localizationPrimarily ERER, mitochondria, and lipid droplets

The significantly more severe phenotype of DGAT2 knockout mice compared to DGAT1 knockouts (nearly absent TG vs. modest reduction) demonstrates that DGAT2 is the predominant enzyme responsible for bulk triglyceride synthesis . When overexpressed in McArdle rat hepatoma cells, DGAT2 caused a much larger increase in intracellular TG levels than DGAT1, further highlighting its dominant role in TG formation .

What are the differences in substrate pool utilization between DGAT1 and DGAT2?

Research indicates that DGAT1 and DGAT2 utilize different substrate pools for triglyceride synthesis:

  • DGAT1: Preferentially utilizes phosphatidylcholine (PC)-derived diacylglycerol (DAG) through a channeling mechanism, suggesting a more specialized role in certain lipid metabolism pathways .

  • DGAT2: Utilizes a larger, more general pool of PC-derived DAG that equilibrates with PC. This enables DGAT2 to incorporate a wider variety of fatty acids into triglycerides .

These differences in substrate utilization partly explain why DGAT2 plays a more significant role in bulk triglyceride synthesis compared to DGAT1. The broader substrate pool accessibility of DGAT2 may be crucial for its ability to efficiently incorporate diverse fatty acids into storage lipids .

What are the optimal expression systems for producing recombinant human DGAT2?

For recombinant expression of human DGAT2, several expression systems have been successfully employed, each with specific advantages:

  • Mammalian expression systems (e.g., HEK293T cells): These provide the most native-like post-translational modifications and membrane environment. Studies have successfully used HEK293T cells for investigating DGAT2 protein-protein interactions and subcellular localization .

  • Yeast expression systems: Despite limitations for studying typical nuclear-targeted proteins, the split ubiquitin yeast two-hybrid technique has been adapted for membrane-bound enzymes like DGAT2. This system has proven valuable for studying protein-protein interactions between DGAT2 and other membrane-associated proteins involved in lipid metabolism .

  • Expression validation methodology: When expressing recombinant DGAT2, researchers should verify both expression level and functionality. This typically involves:

    • Western blotting for protein expression using epitope tags (e.g., FLAG, Myc)

    • Enzymatic activity assays measuring DAG to TAG conversion

    • Lipid droplet formation analysis via microscopy with lipid-specific dyes

What techniques are most effective for studying DGAT2 protein-protein interactions?

Several complementary techniques have proven effective for investigating DGAT2 interactions:

  • Split ubiquitin yeast two-hybrid analysis: This adapted technique is particularly valuable for membrane-bound enzymes like DGAT2. It has successfully demonstrated interactions between DGAT2 and other lipid metabolism enzymes, including LPCAT2 (involved in acyl editing) and PDCT (involved in PC-derived DAG production) .

  • Co-immunoprecipitation (Co-IP): Studies have utilized epitope-tagged versions of DGAT2 (e.g., FLAG-tagged DGAT2 and Myc-tagged DGAT2) co-expressed in mammalian cells. This approach successfully demonstrated that DGAT2 forms multimeric complexes through interactions between individual subunits .

  • Deletion mutant analysis: By creating deletion mutants and performing Co-IP experiments, researchers identified that DGAT2 has multiple domains in both N and C termini that mediate subunit interaction .

How are DGAT2 mutations implicated in cancer development?

Analysis of cancer databases has revealed significant insights into DGAT2 mutations in cancer:

  • Mutation profile: The Catalogue of Somatic Mutations in Cancer (COSMIC) database has identified 398 DGAT2 mutations across 21 different cancer types. The highest frequency of missense mutations occurs in skin tissue samples (f = 21), followed by lungs (f = 16), large intestines (f = 16), and endometrium (f = 15) .

  • Cancer types: Carcinomas show the highest prevalence of DGAT2 mutations, followed by malignant melanomas. The age distribution reveals that carcinomas and malignant melanomas linked to DGAT2 mutations typically occur in the 50-70 age group .

  • Mutation significance: While DGAT2 mutations are not identified as cancer drivers, several mutations within the catalytic site show high pathogenicity scores. The D222V mutation represents a notable hotspot, neighboring the Y223H mutation associated with Axonal Charcot-Marie-Tooth disease .

  • Age correlation: Higher pathogenicity mutations correlate with specimens from patients older than 40 years, with carcinomas and melanomas from older patients showing statistically enriched levels of pathogenic mutations .

Cancer TissueMutation FrequencyNotable Characteristics
Skin21Highest frequency of missense mutations
Lung16High pathogenic score cluster
Large Intestine16High pathogenic score cluster
Endometrium15-
EsophagusNot specifiedHigh pathogenic score cluster

What role does DGAT2 play in viral infection mechanisms?

Recent research has uncovered a crucial role for DGAT2 in flavivirus replication, particularly for Zika virus (ZIKV):

  • Proviral function: DGAT2 depletion significantly inhibits ZIKV replication in multiple cell lines, and this inhibition can be reversed through trans-complementation with DGAT2. This indicates DGAT2 serves a proviral role in ZIKV infection .

  • Viral complex recruitment: DGAT2 is recruited into the viral replication complex through direct interactions with non-structural (NS) proteins of the virus .

  • Protease targeting: Both human and murine DGAT2 can be cleaved by the viral protease NS2B3 at the specific 122R-R-S124 site. This represents a novel mechanism by which DGAT2 is hijacked by the virus .

  • Functional consequences: The cleaved DGAT2 product becomes more stable and promotes lipid droplet formation independently of its enzymatic activity. This enhanced lipid droplet formation likely provides structural platforms and energy reservoirs that support viral replication .

This mechanism represents a significant insight into host-virus interactions and identifies DGAT2 as a potential therapeutic target for antiviral strategies against flaviviruses.

How can DGAT2 subcellular localization be manipulated for experimental studies?

Understanding and manipulating DGAT2 subcellular localization provides valuable insights into its function:

What are the implications of DGAT2 multimeric complex formation for drug development?

The discovery that DGAT2 forms multimeric complexes has significant implications for therapeutic development:

  • Complex formation mechanism: DGAT2 subunits interact through multiple domains in both N and C termini. This multimerization likely affects enzyme activity, substrate accessibility, and interactions with other proteins in lipid metabolic networks .

  • Drug development considerations:

    • Targeting protein-protein interaction surfaces between DGAT2 subunits could provide novel mechanisms to modulate activity

    • Compounds that alter the quaternary structure might have different effects than those targeting the catalytic site

    • Understanding which regions mediate interactions with different partners could allow selective disruption of specific functions while preserving others

  • Research methodology: Investigators studying DGAT2 as a drug target should:

    • Employ techniques like FRET or BRET to study complex formation in living cells

    • Utilize in silico modeling to identify potential binding pockets at subunit interfaces

    • Develop assays that can distinguish between effects on catalytic activity versus complex formation

How can genomic and proteomic approaches be integrated to advance DGAT2 research?

A comprehensive understanding of DGAT2 requires integration of genomic and proteomic approaches:

  • Multi-omics strategy:

    • Genomic analysis to identify genetic variants and expression patterns

    • Transcriptomic profiling to understand tissue-specific expression and splicing

    • Proteomic approaches to characterize post-translational modifications and interaction partners

    • Lipidomic analysis to link DGAT2 activity to specific lipid profiles

  • Research applications:

    • Correlation between specific DGAT2 mutations and altered lipid profiles in patient samples

    • Identification of tissue-specific interaction partners that might explain differential functions

    • Characterization of post-translational modifications that regulate DGAT2 activity in different physiological states

  • Methodological approach:

    • CRISPR-Cas9 genome editing to introduce specific mutations

    • Proximity labeling techniques (BioID, APEX) to identify interaction partners in living cells

    • Mass spectrometry to characterize post-translational modifications

    • Single-cell analysis to understand heterogeneity in DGAT2 function within tissues

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.