Recombinant Human Disintegrin and metalloproteinase domain-containing protein 20 (ADAM20)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Disintegrin and Metalloproteinase Domain-Containing Protein 20 (ADAM20)

Recombinant Human Disintegrin and Metalloproteinase Domain-Containing Protein 20 (ADAM20) is a protein encoded by the ADAM20 gene in humans. It belongs to the ADAM family of proteins, which are characterized by their disintegrin and metalloproteinase domains. ADAM20 is specifically expressed in the testes and is thought to play a role in sperm maturation and fertilization processes, similar to other sperm cell-specific proteins like fertilins .

Structure of ADAM20

ADAM20, like other ADAM family members, contains several distinct domains:

  • N-terminal propeptide: Acts as both a signal peptide and an activator domain.

  • Metalloproteinase domain: Contains a reprolysin-type active site, although its catalytic activity is debated.

  • Disintegrin domain: Involved in interactions with integrins, potentially mediating sperm-egg binding.

  • Cysteine-rich domain: Contributes to protein-protein interactions .

DomainFunction
N-terminal propeptideSignal peptide and activator domain
Metalloproteinase domainPotential proteolytic activity, though debated
Disintegrin domainInteracts with integrins, possibly involved in sperm-egg binding
Cysteine-rich domainFacilitates protein-protein interactions

Functions of ADAM20

ADAM20 is believed to be involved in sperm maturation and fertilization. It may play a role in sperm-zona binding or the migration of sperm from the uterus into the oviduct. The disintegrin-like domain could interact with integrin receptors on the egg, facilitating sperm-egg adhesion .

Predicted Functional Partners

ADAM20 interacts with several proteins involved in fertilization processes:

ProteinFunction
ADAM2Involved in sperm-egg plasma membrane adhesion and fusion
ADAM21May be involved in sperm maturation and/or fertilization
SPAM1Aids in penetrating cumulus cells by digesting hyaluronic acid
OVGP1Binds to oocyte zona pellucida, potentially involved in fertilization
ZP4Component of the zona pellucida, mediates sperm binding

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
ADAM20; Disintegrin and metalloproteinase domain-containing protein 20; ADAM 20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
207-726
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
ADAM20
Target Protein Sequence
RFVELVVVVDNIRYLFSQSNATTVQHEVFNVVNIVDSFYHPLEVDVILTGIDIWTASNPLPTSGDLDNVLEDFSIWKNYNLNNRLQHDVAHLFIKDTQGMKLGVAYVKGICQNPFNTGVDVFEDNRLVVFAITLGHELGHNLGMQHDTQWCVCELQWCIMHAYRKVTTKFSNCSYAQYWDSTISSGLCIQPPPYPGNIFRLKYCGNLVVEEGEECDCGTIRQCAKDPCCLLNCTLHPGAACAFGICCKDCKFLPSGTLCRQQVGECDLPEWCNGTSHQCPDDVYVQDGISCNVNAFCYEKTCNNHDIQCKEIFGQDARSASQSCYQEINTQGNRFGHCGIVGTTYVKCWTPDIMCGRVQCENVGVIPNLIEHSTVQQFHLNDTTCWGTDYHLGMAIPDIGEVKDGTVCGPEKICIRKKCASMVHLSQACQPKTCNMRGICNNKQHCHCNHEWAPPYCKDKGYGGSADSGPPPKNNMEGLNVMGKLRYLSLLCLLPLVAFLLFCLHVLFKKRTKSKEDEEG
Uniprot No.

Target Background

Function
Potentially involved in sperm maturation and/or fertilization.
Database Links

HGNC: 199

OMIM: 603712

KEGG: hsa:8748

STRING: 9606.ENSP00000256389

UniGene: Hs.177984

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Testis specific.

Q&A

What is ADAM20 and what is its genomic location?

ADAM20, formally known as A Disintegrin And Metalloprotease 20 or Disintegrin and metalloproteinase domain-containing protein 20, is a member of the ADAM family of metalloproteinases. The human ADAM20 gene is located on chromosome 14q24.1 . The protein contains characteristic domains common to ADAM family members: a metalloproteinase domain that confers enzymatic activity, a disintegrin domain, a cysteine-rich region, and a cytoplasmic tail that varies in length and sequence between different family members . ADAM20 is among the ADAMs that possess catalytic metalloproteinase activity, distinguishing it from some other family members that lack this function .

What tissues express ADAM20 and what is its primary function?

ADAM20 displays a relatively restricted expression pattern compared to some other ADAM family members. It is primarily expressed in testis, with additional expression detected in erythrocytes and bone marrow . This tissue-specific distribution suggests specialized functions related to reproductive biology, particularly spermatogenesis and possibly sperm-egg interactions. Recent research has implicated ADAM20 in sperm-egg fusion processes, with mutations potentially associated with fertility disorders . The protein's metalloproteinase activity suggests it may participate in the processing or shedding of cell surface proteins during gametogenesis or fertilization, although specific substrates remain to be fully characterized.

What are the key structural features of recombinant ADAM20 proteins used in research?

Commercially available recombinant human ADAM20 proteins typically include specific regions of the native protein. For example, one commonly used recombinant form encompasses amino acids His367 to Gly615 with an N-terminal His Tag to facilitate purification . This recombinant protein has a theoretical molecular weight of approximately 30kDa and is typically expressed in prokaryotic systems such as E. coli . It's important to note that such recombinant proteins may lack certain domains of the full-length protein, which might affect functional studies. When designing experiments, researchers should consider whether the specific domains required for their studies are present in the recombinant construct.

How should researchers optimize expression and purification of recombinant ADAM20?

When expressing recombinant ADAM20, researchers should consider several key factors to maximize yield and functional integrity. For prokaryotic expression systems like E. coli, codon optimization of the ADAM20 sequence is crucial to account for differences in codon usage between humans and bacteria. Expression conditions including temperature (typically lowered to 18-25°C after induction), inducer concentration, and duration should be systematically optimized through pilot experiments.

For purification, a two-step approach is recommended: initial capture using affinity chromatography (leveraging the His-tag with Ni-NTA resin) , followed by size exclusion chromatography to remove aggregates and improve homogeneity. Buffer composition is critical - PBS at pH 7.4 with stabilizing agents such as 0.01% SKL and 5% Trehalose has been shown to maintain ADAM20 stability . Quality control should include SDS-PAGE to verify purity (aim for >97%), endotoxin testing (<1.0EU per μg), and activity assays to confirm the protein retains its metalloproteinase function.

What cellular models are most appropriate for studying ADAM20 function?

Given ADAM20's tissue-specific expression pattern, selecting appropriate cellular models is crucial for meaningful functional studies. Primary testicular cells or testis-derived cell lines represent the most physiologically relevant systems. For reproductive studies, co-culture systems using oocytes and sperm may be required to investigate ADAM20's role in fertilization .

When heterologous expression systems are necessary, consider human cell lines with minimal endogenous ADAM expression to reduce background activity. The CRISPR-Cas9 system can be employed to generate ADAM20 knockout models for loss-of-function studies, while lentiviral vectors can facilitate stable expression for gain-of-function experiments. Importantly, functional redundancy between ADAM family members may complicate interpretation of results, so parallel assessment of related ADAMs (particularly those expressed in reproductive tissues) may be necessary to comprehensively understand specific versus overlapping functions.

What are the best approaches for detecting ADAM20 expression in tissue or cell samples?

Multiple complementary approaches should be employed for robust detection of ADAM20. At the mRNA level, quantitative RT-PCR using primers spanning exon junctions can quantify expression with high sensitivity. RNA-seq provides broader context by revealing alternative splicing patterns and co-expressed genes.

For protein detection, western blotting with antibodies against distinct ADAM20 epitopes helps confirm specificity. When selecting antibodies, those recognizing the metalloproteinase domain may be particularly useful for distinguishing between pro-form and active ADAM20. Immunohistochemistry and immunofluorescence can localize ADAM20 within tissues and cells, with particular attention to subcellular compartments. Flow cytometry is valuable for quantifying surface expression on specific cell populations, especially in heterogeneous samples like testicular tissue.

For all detection methods, appropriate controls are essential: positive controls (tissues known to express ADAM20 such as testis), negative controls (tissues without ADAM20 expression), and specificity controls (pre-absorption with recombinant ADAM20 protein).

How can researchers investigate ADAM20's role in sperm-egg fusion and fertility disorders?

Investigating ADAM20's role in fertilization requires a multi-faceted approach combining genetic, biochemical, and cellular techniques. Genetic screening of infertile male patients, particularly those with unexplained fertilization failure, can identify potential ADAM20 mutations or variants . Whole-exome sequencing represents a powerful approach to identify such variants, as demonstrated in studies of Chinese male patients with sperm-egg fusion disorders .

For functional validation, in vitro fertilization assays using sperm from wild-type versus ADAM20-deficient models can directly assess fertilization rates. Zona-free oocyte binding assays specifically evaluate sperm-egg membrane interactions. Complementation experiments, introducing wild-type or mutant ADAM20 into ADAM20-deficient sperm through methods like recombinant protein loading, can confirm causality of specific variants.

At the molecular level, identifying ADAM20's binding partners on the oocyte surface is crucial. Techniques such as proximity labeling, co-immunoprecipitation followed by mass spectrometry, and surface plasmon resonance can characterize these interactions. Researchers should consider potential redundancy with other ADAMs (such as ADAM1, ADAM2, and ADAM3) that have established roles in gamete interactions.

What approaches can reveal potential substrates and enzymatic mechanisms of ADAM20?

Identifying ADAM20 substrates requires systematic proteomic strategies. Terminal amine isotopic labeling of substrates (TAILS) can identify proteins cleaved by ADAM20 in complex biological samples. This approach involves differential labeling of N-termini generated by proteolytic processing, allowing identification of novel cleavage sites.

For candidate substrate validation, in vitro cleavage assays using purified recombinant ADAM20 and potential substrate proteins can confirm direct processing. ADAM20's activity may be regulated by tissue inhibitors of metalloproteinases (TIMPs), similar to other ADAM family members, so investigating these interactions is important . Enzyme kinetics studies measuring the rate of substrate cleavage under varying conditions (pH, ion concentration, temperature) provide insights into optimal ADAM20 activity parameters.

Structural studies using techniques like X-ray crystallography or cryo-EM can reveal the conformation of ADAM20's catalytic site and substrate-binding pocket, informing rational design of selective inhibitors or activators. Computational approaches like molecular docking and molecular dynamics simulations can predict substrate binding modes and guide experimental validation.

How does ADAM20 interact with other proteins in the ADAM family, and what are the implications for redundancy or compensation?

Understanding ADAM20's relationship to other ADAM family members requires comparative genomics and functional studies. Phylogenetic analysis can identify the most closely related ADAMs (particularly ADAM21, which is located in the same chromosomal region) . Expression correlation analysis across tissues and developmental stages can identify co-regulated ADAM proteins that might function in the same pathways.

Gene knockout studies in model organisms should carefully assess the expression of other ADAM family members to identify potential compensatory upregulation. Compound knockout models targeting multiple ADAMs may reveal functions masked by redundancy in single knockouts. Domain swapping experiments, where specific domains of ADAM20 are exchanged with corresponding domains from other ADAMs, can pinpoint regions responsible for unique versus shared functions.

Co-immunoprecipitation and proximity ligation assays can determine whether ADAM20 physically interacts with other ADAM proteins to form functional complexes. Given that several ADAMs are expressed in testicular tissue, coordinated regulation of their activity may be critical for proper reproductive function.

What are common pitfalls in ADAM20 activity assays and how can they be addressed?

Activity assays for ADAM20 face several technical challenges that researchers should anticipate. The lack of known physiological substrates necessitates using generic metalloproteinase substrates, which may not optimally reflect ADAM20-specific activity. When designing assays, researchers should test multiple fluorogenic peptide substrates with different cleavage site preferences to identify those most efficiently processed by ADAM20.

Maintaining ADAM20's native conformation during purification is critical for preserving activity. Improper protein folding, particularly of the disintegrin and metalloproteinase domains, can occur during recombinant expression. Including proper controls in activity assays is essential: heat-inactivated ADAM20 as a negative control, broad-spectrum metalloproteinase inhibitors (e.g., EDTA, 1,10-phenanthroline) to confirm metalloproteinase-dependent activity, and ADAM-family specific inhibitors to distinguish from other classes of proteases.

The presence of endogenous inhibitors in biological samples can mask ADAM20 activity. Preprocessing samples to remove TIMPs or other inhibitors may be necessary. Additionally, ADAM20 may require specific cofactors or activation conditions that should be systematically investigated, including various metal ions (Zn²⁺, Ca²⁺), pH ranges, and potential activator proteins.

How should researchers interpret conflicting data about ADAM20 function in different experimental systems?

When facing contradictory results across experimental systems, researchers should implement a systematic approach to reconcile discrepancies. First, carefully evaluate the specific ADAM20 constructs used in different studies - variations in included domains, tags, or expression systems can significantly impact function . Full-length versus truncated versions may behave differently, as critical regulatory elements might be absent in partial constructs.

Species differences should be considered, as ADAM20 function may not be fully conserved between humans and model organisms. Cell type-specific factors can also influence ADAM20 activity - the protein may require tissue-specific cofactors or post-translational modifications absent in heterologous expression systems. Experimental conditions including buffer composition, pH, and presence of metal ions can dramatically affect activity and should be standardized across comparative studies.

To resolve conflicts, direct comparative studies under identical conditions are valuable. Employing multiple complementary techniques to address the same question can provide convergent evidence. Meta-analysis of published data with attention to methodological differences can help identify patterns explaining seemingly contradictory results. Collaborative research involving labs reporting different outcomes can be particularly effective in pinpointing sources of variation.

How might ADAM20 be involved in pathological conditions beyond fertility disorders?

Though primarily associated with reproductive biology, emerging evidence suggests ADAM20 may have roles in other physiological or pathological processes. The protein's expression in erythrocytes and bone marrow points to potential functions in hematopoiesis . Researchers should investigate whether ADAM20 participates in erythrocyte membrane remodeling or maturation through its proteolytic activity.

The involvement of other ADAM family members in cancer progression raises questions about ADAM20's potential contributions to malignancy. While some ADAMs promote tumor development by stimulating cell proliferation through EGFR activation or by inducing epithelial-mesenchymal transition via E-cadherin cleavage , ADAM20's specific roles remain unexplored. Gene expression databases should be mined for correlations between ADAM20 expression and cancer outcomes.

Beyond cancer, the broader ADAM family participates in various processes including inflammatory responses, neurodevelopment, and tissue remodeling . Systematic screening of ADAM20 activity against protein substrates involved in these processes could reveal unexpected functions. Researchers should consider potential non-catalytic functions mediated through ADAM20's disintegrin domain, which might participate in cell adhesion processes independent of proteolytic activity.

What genetic approaches can reveal ADAM20's physiological importance and evolutionary conservation?

Modern genetic approaches offer powerful tools to elucidate ADAM20's biological significance. CRISPR-Cas9-mediated genome editing can generate ADAM20 knockout models in various organisms to assess phenotypic consequences. Particular attention should be paid to reproductive parameters, given ADAM20's expression pattern . Conditional knockout systems using tissue-specific promoters can help distinguish direct versus indirect effects and developmental versus adult functions.

Human genetic studies using genome-wide association studies (GWAS) and methylation quantitative trait loci (mQTL) approaches can identify correlations between ADAM20 variants and phenotypic traits . For reproductive disorders specifically, targeted sequencing of ADAM20 in infertile patients with normal sperm parameters but fertilization failure may reveal clinically relevant variants .

Evolutionary analysis comparing ADAM20 sequences across species can identify conserved regions likely critical for function. Positive selection analysis can pinpoint amino acids under evolutionary pressure, potentially revealing sites of species-specific adaptations in reproductive biology. Comparative expression studies examining ADAM20 orthologs across evolutionary distant organisms can shed light on conserved versus divergent functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.