Recombinant Human Disintegrin and metalloproteinase domain-containing protein 23 (ADAM23)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

ADAM23 (ADAM Metallopeptidase Domain 23) is a protein-coding gene located on chromosome 2. It encodes a member of the ADAM family involved in various biological processes including fertilization, muscle development, and neurogenesis . As a membrane-anchored protein, ADAM23 is structurally related to snake venom disintegrins, containing multiple functional domains that contribute to its diverse biological roles.

Genetic Identifiers

ADAM23 is well-characterized genetically, with consistent identifiers across multiple databases that facilitate research continuity and data integration.

Identifier TypeID
HGNC202
NCBI Gene8745
EnsemblENSG00000114948
OMIM®603710
UniProtKB/Swiss-ProtO75077
mRNA RefseqNM_003812
Protein RefseqNP_003803

Protein Structure and Domains

ADAM23 is a non-catalytic metalloprotease-like protein . Unlike some other members of the ADAM family, ADAM23 lacks proteolytic activity but retains important adhesive functions. The protein structure prediction from the Alphafold project includes one chain with 413 population variants identified . The Human Protein Atlas provides predicted structures from the Alphafold protein structure database and experimental structures from the Protein Data Bank (PDB), offering valuable insights into ADAM23's three-dimensional configuration .

Expression Systems

Recombinant ADAM23 production predominantly utilizes bacterial expression systems. The disintegrin-like domain of ADAM23 has been successfully produced in Escherichia coli and used for functional studies demonstrating its cell adhesion properties . This expression system provides a cost-effective method for generating sufficient quantities of the protein for research applications.

Protein Sequence and Formulation

The recombinant ADAM23 fragment (amino acids 621-710) has the following amino acid sequence:
GSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVED

Commercial preparations are typically formulated in 0.15 M Phosphate buffered saline and should be stored at -20 to -80°C for long-term stability, with recommendations to avoid repeated freeze-thaw cycles .

Cell Adhesion Mechanisms

The disintegrin-like domain of ADAM23 demonstrates significant cell adhesion properties. When immobilized on culture dishes, recombinant ADAM23 promotes the attachment of various human cells of neural origin, including neuroblastoma cells (NB100 and SH-S y5 y) and astrocytoma cells (U373 and U87 MG) . This adhesion functionality suggests important roles in neural development and potentially in neural repair mechanisms.

Integrin Binding

ADAM23 exhibits a specific interaction with the αvβ3 integrin, mediated by a short amino acid sequence present in its putative disintegrin loop . Notably, this interaction occurs through an RGD-independent mechanism, distinguishing it from other disintegrins that typically rely on RGD motifs for αvβ3-mediated interactions . This unique binding mechanism expands our understanding of integrin-ligand interactions and suggests potential specificity in ADAM23's biological functions.

Cellular Signaling

In cardiomyocytes, ADAM23 functions as a negative regulator of cardiac hypertrophy by inhibiting the focal adhesion kinase-protein kinase B (FAK-AKT) signaling pathway . This inhibitory effect on a major cellular signaling cascade demonstrates ADAM23's importance in maintaining cardiac homeostasis and preventing pathological cardiac remodeling.

Neurological Function and Disease

ADAM23 is highly expressed in fetal and adult brain tissue, indicating important neurological functions . Recent research has established significant associations between ADAM23 and neurological disorders, particularly epilepsy. A gene-burden meta-analysis of 748,879 individuals identified ADAM23 as a novel candidate gene contributing to human epilepsy, potentially through its direct interaction with LGI1, a known epilepsy gene .

Disease Associations

DiseaseAssociation TypeEvidence Level
Epilepsy, Familial Temporal Lobe, 1Primary associationGenetic studies
Anterograde AmnesiaAssociated conditionClinical observation
Cancer/TumorigenesisPotential associationGene inactivation studies

Cardiovascular Function and Disease

Research has identified ADAM23 as playing a critical role in cardiac health. Expression of ADAM23 is decreased in both failing human hearts and hypertrophic mice hearts, suggesting its involvement in cardiac pathology . Cardiac-specific conditional ADAM23-knockout mice exhibited exacerbated cardiac hypertrophy, fibrosis, and dysfunction, while transgenic mice overexpressing ADAM23 showed reduced cardiac hypertrophy in response to pressure overload . These findings position ADAM23 as a potential therapeutic target for cardiac hypertrophy.

Neurological Research

The strong association between ADAM23 and epilepsy makes recombinant ADAM23 a valuable tool in neurological research. Its interaction with LGI1 provides a mechanistic pathway for investigating epileptogenesis . Phenome-wide analyses have highlighted that ADAM23 exhibits predominantly neurological effects, distinguishing it from other genes that show broader systemic involvement .

Cardiovascular Research

In cardiovascular studies, recombinant ADAM23 has been instrumental in investigating the mechanisms underlying cardiac hypertrophy. Research using recombinant ADAM23 has demonstrated that focal adhesion kinase inactivation by the inhibitor PF-562271 significantly reversed the detrimental effects observed in ADAM23-knockout mice subjected to aortic banding . These findings suggest that targeting the FAK-AKT pathway could be a promising therapeutic approach for cardiac hypertrophy.

Cell Adhesion Studies

The ability of recombinant ADAM23 to promote cell attachment through αvβ3 integrin interaction makes it a useful tool for studying cell adhesion mechanisms . This property has applications in cancer research, neurological studies, and investigations of cell migration and tissue organization. Researchers have demonstrated that HeLa cells transfected with a full-length cDNA for ADAM23 exhibit enhanced adhesion, extending the findings obtained with recombinant protein containing only the disintegrin domain .

Therapeutic Potential

Given its role as a negative regulator of cardiac hypertrophy and its association with epilepsy, ADAM23 represents a promising therapeutic target for both cardiovascular and neurological disorders . The development of ADAM23-targeting therapies could potentially provide new approaches for treating conditions like heart failure and epilepsy, where current treatment options remain suboptimal.

Diagnostic Applications

The association of ADAM23 with specific disease states suggests potential diagnostic applications. Detection of ADAM23 expression levels or identification of ADAM23 variants could serve as biomarkers for disease risk, progression, or response to therapy, particularly in epilepsy and cardiac conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific requirements. Please indicate your preferred format in your order notes, and we will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on your purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All protein shipments are standardly packaged with blue ice packs. For dry ice shipping, please notify us in advance for an additional fee.
Notes
Repeated freezing and thawing should be avoided. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To enhance long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol includes 50% glycerol, which can serve as a reference for your use.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein. Generally, liquid form exhibits a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during our production process. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
ADAM23; MDC3; Disintegrin and metalloproteinase domain-containing protein 23; ADAM 23; Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3; MDC-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
287-832
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
ADAM23
Target Protein Sequence
AVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYECRDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYNGECKTRDNQCQYIWGTKAAGSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMCLDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNLHPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI
Uniprot No.

Target Background

Function
ADAM23, a non-catalytic metalloprotease-like protein, potentially plays a role in cell-cell and cell-matrix interactions.
Gene References Into Functions
  1. Decreased methylation levels of the SNAI2 and ADAM23 genes have been linked to cancer de-differentiation and haematogenous dissemination, respectively. This suggests novel roles for these genes in invasive processes. PMID: 30189837
  2. Our research indicates that ADAM23 expression is likely involved in the progression of epithelial ovarian cancer. PMID: 29921495
  3. ADAM23 regulates neuronal differentiation by activating specific signaling pathways during human neural progenitor cells differentiation. PMID: 28828010
  4. These findings support the existence of an alternative mechanism to inhibiting protein secretion, through which ADLTE-causing LGI1 mutations exert their loss-of-function effect extracellularly. This suggests that interactions between LGI1 and both ADAM22 and ADAM23 play a crucial role in the molecular mechanisms underlying autosomal dominant lateral temporal epilepsy. PMID: 27760137
  5. Our data demonstrate that ADAM23 contributes to the suppression of cancer cell progression through interaction with aVb3 integrin. The downregulation of ADAM23 in SP cells may contribute to the development of a cancer stem cell phenotype. PMID: 26800504
  6. High methylation of the ADAM23 gene has been associated with increased gastric tumor aggressiveness. PMID: 25740824
  7. The quantification of CXCL12 and ADAM23 methylation could be a valuable tool for predicting advanced stages of breast cancer. PMID: 25620615
  8. Intratumoral heterogeneity of ADAM23 promotes tumor growth and metastasis through LGI4 and nitric oxide signaling pathways. PMID: 24662834
  9. The expression level of ADAM23 is likely to be involved in the progression of non-small-cell lung carcinoma. Its downregulation appears to be correlated with promoter methylation. PMID: 21429053
  10. A SP1 binding site (-202/-190) has been identified at the proximal promoter of the human ADAM23 gene, where SP1 binds. PMID: 20851106
  11. Our findings indicate that ADAM23 down-regulation by methylation in brain tumors is a rare event. This might explain why brain tumor metastases are infrequently found in other parts of the body. PMID: 15862898
  12. ADAM23 is frequently silenced in gastric cancers due to homozygous deletion or aberrant promoter methylation. PMID: 16103878
  13. Aberrant promoter hypermethylation during the progression of colorectal cancer may lead to the down-regulation of ADAM23. PMID: 19089928
  14. PrP(C) is a novel molecular partner for ADAM23 in the nervous systems. PMID: 19477226
  15. ADAM23 plays a functional role during lung cancer metastatic progression by negatively modulating alpha(v)beta(3) integrin activation. PMID: 19549921

Show More

Hide All

Database Links

HGNC: 202

OMIM: 603710

KEGG: hsa:8745

STRING: 9606.ENSP00000264377

UniGene: Hs.370287

Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Isoform Gamma]: Secreted.
Tissue Specificity
Highly expressed in the brain and weakly expressed in the heart. In the brain, expressed prominently in the amygdala, caudate nucleus, hypothalamus, thalamus, cerebral cortex and occipital pole.

Q&A

What is the standard methodology for generating cardiac-specific ADAM23 transgenic mouse models?

Cardiac-specific ADAM23 transgenic mice can be generated using a Cre-Lox conditional expression system. The methodology involves:

  • Obtaining the full-length cDNA for mouse ADAM23 by polymerase chain reaction (PCR)

  • Sequencing the cDNA to verify integrity

  • Inserting the cDNA into a pCAG-loxP-CAT-loxp-lacZ plasmid by replacing the LacZ gene

  • Generating the pCAG-CAT-mADAM23 plasmid containing the CAG promoter and LoxP-flanked CAT gene

  • Linearizing the transgene vector and microinjecting it into fertilized murine embryos (C57BL/6J)

  • Characterizing offspring genotypes via PCR on tail DNA samples

  • Breeding CAG-CAT-mADAM23 mice with α-MHC-MerCreMer mice to generate double-transgenic mice

  • Inducing Cre-mediated recombination with tamoxifen injection (25 mg/kg daily for five consecutive days)

This approach allows for temporal control of ADAM23 overexpression specifically in cardiomyocytes, enabling precise examination of its functional role in the heart.

How can researchers effectively create cardiac-specific ADAM23 knockout models?

Cardiac-specific ADAM23 knockout (cADAM23-KO) mice can be established using the CRISPR/Cas9 system through the following protocol:

  • Clone the exon 3 coding sequence region of mouse ADAM23 gene and flank it with two mLoxP sequences

  • Clone the recombinant DNA fragment into a vector containing homology arms (approximately 1153 and 1414 bp)

  • Design two single-guide RNAs targeting locations in the CDS region using online tools (http://crispr.mit.edu/)

  • Synthesize and validate sgRNAs for specificity and function in vitro

  • Inject Cas9 mRNA, sgRNAs, and donor vector into C57BL/6J mouse zygotes

  • Transplant injected zygotes into surrogate mother mice

  • Identify founder mice with floxed CDS regions on the same allele

  • Confirm floxed allele functionality through in vitro Cre/loxP-mediated recombination

  • Breed with cardiac-specific Cre-expressing mice to generate tissue-specific knockouts

This approach provides a powerful tool to study the loss-of-function effects of ADAM23 specifically in cardiac tissue, eliminating potentially confounding developmental effects from global knockout.

What are the optimal methods for culturing and manipulating primary cardiomyocytes to study ADAM23 function?

The preparation and manipulation of neonatal rat cardiomyocytes (NRCMs) for ADAM23 studies follows these methodological steps:

  • Harvest hearts from 1-day-old Sprague-Dawley rats

  • Excise, mince, and digest the tissue with trypsin

  • Pass digested tissue through a 40-μm cell strainer

  • Use differential attachment technique to remove fibroblasts

  • Seed cardiomyocytes in DMEM/F12 medium containing 20% fetal bovine serum, BrdU (to inhibit fibroblast proliferation), and antibiotics

  • For knockdown experiments, clone rat shADAM23 constructs into adenoviral vectors (using non-targeting AdshRNA as control)

  • For overexpression, subclone the entire coding region of rat ADAM23 gene under cytomegalovirus promoter control into adenoviral vectors (AdADAM23), using AdGFP as control

  • Infect cultured NRCMs with respective adenoviral constructs at a multiplicity of infection of 100 for 24 hours

  • Replace medium with DMEM/F12 containing 1% fetal bovine serum for 12 hours to synchronize cardiomyocytes

  • Stimulate cells with angiotensin II (1 μmol/L) or PBS (control) for 48 hours

This protocol enables reliable in vitro analysis of ADAM23 function in cardiomyocytes and is suitable for assessing hypertrophic responses through immunofluorescence staining and gene expression analysis.

What techniques are recommended for producing and purifying the disintegrin-like domain of ADAM23?

For functional studies of the ADAM23 disintegrin-like domain, researchers can employ the following production and purification approach:

  • Design and synthesize expression constructs containing the disintegrin-like domain sequence

  • Express the recombinant protein in Escherichia coli expression systems

  • Optimize expression conditions (temperature, induction time, and IPTG concentration)

  • Lyse bacterial cells and solubilize the target protein

  • Perform affinity chromatography using appropriate tags (e.g., His-tag) for initial purification

  • Apply additional purification steps as needed (ion exchange, size exclusion chromatography)

  • Verify purity by SDS-PAGE and Western blotting

  • Confirm biological activity through cell adhesion assays

The purified disintegrin-like domain can then be immobilized on culture dishes to assess its ability to promote attachment of different human cells, particularly those of neural origin such as neuroblastoma cells (NB100, SH-SY5Y) or astrocytoma cells (U373, U87 MG).

What methods are most appropriate for analyzing ADAM23 expression in tissue samples?

Analysis of ADAM23 expression in tissue samples can be approached through multiple complementary techniques:

  • RT-qPCR Analysis:

    • Extract total RNA from tissue samples using standard protocols

    • Perform reverse transcription to generate cDNA

    • Design specific primers for human or mouse ADAM23

    • Quantify expression levels relative to appropriate housekeeping genes

  • Western Blot Analysis:

    • Extract proteins from tissue samples using appropriate lysis buffers

    • Separate proteins by SDS-PAGE and transfer to membranes

    • Probe with validated anti-ADAM23 antibodies

    • Visualize and quantify signals using appropriate detection systems

  • Immunohistochemistry (IHC):

    • Prepare formalin-fixed paraffin-embedded (FFPE) tissue sections

    • Perform antigen retrieval if necessary

    • Incubate with primary anti-ADAM23 antibodies

    • Apply appropriate detection systems (e.g., HRP-conjugated secondary antibodies)

    • Analyze staining patterns and intensity

  • Methylation Analysis (for epigenetic regulation):

    • Extract DNA from tissue samples

    • Perform bisulfite conversion of DNA

    • Analyze ADAM23 promoter methylation level by quantitative pyrosequencing

    • Design amplification primers for the region of interest

These complementary approaches provide comprehensive analysis of ADAM23 expression at mRNA, protein, and epigenetic regulation levels.

How can researchers comprehensively evaluate the role of ADAM23 in the FAK/AKT signaling pathway during cardiac hypertrophy?

To evaluate ADAM23's role in FAK/AKT signaling during cardiac hypertrophy, researchers should implement a multi-level experimental approach:

  • In vivo signaling analysis:

    • Subject ADAM23 transgenic and knockout mice to pressure overload via aortic banding (AB)

    • Harvest cardiac tissue at defined timepoints post-surgery

    • Prepare protein lysates and perform Western blot analysis for:

      • Phosphorylated and total FAK

      • Phosphorylated and total AKT

      • Downstream molecules: GSK3β and mTOR (both phosphorylated and total forms)

    • Compare expression and activation patterns between experimental groups

  • In vitro validation:

    • Manipulate ADAM23 expression in NRCMs using adenoviral vectors

    • Treat cells with hypertrophic stimuli (e.g., angiotensin II)

    • Analyze FAK/AKT pathway activation by Western blotting

    • Perform time-course experiments to determine signaling kinetics

  • Pharmacological intervention:

    • Treat ADAM23-deficient mice with FAK inhibitors (e.g., PF-562271)

    • Evaluate the rescue of hypertrophic phenotypes through:

      • Heart weight/body weight ratios

      • Heart weight/tibia length ratios

      • Echocardiographic assessment

      • Histological analysis of cardiomyocyte size and fibrosis

    • Confirm pathway inhibition via Western blotting

This comprehensive approach allows for mechanistic understanding of how ADAM23 regulates cardiac hypertrophy through the FAK/AKT signaling pathway.

What experimental designs best elucidate ADAM23's interaction with integrin αvβ3?

The investigation of ADAM23-integrin αvβ3 interactions requires specialized experimental designs:

  • Binding assays:

    • Express and purify the disintegrin-like domain of ADAM23

    • Immobilize the recombinant protein on plates or beads

    • Incubate with soluble purified integrins or cell lysates containing integrins

    • Detect interactions using specific antibodies

    • Perform competition assays with known integrin ligands to determine specificity

  • Cell adhesion assays:

    • Coat culture dishes with recombinant ADAM23 disintegrin-like domain

    • Plate various cell types (particularly neuroblastoma and astrocytoma cells)

    • Quantify cell attachment and spreading

    • Perform inhibition studies using:

      • Anti-integrin blocking antibodies

      • Integrin-binding peptides

      • Soluble recombinant integrins

  • Transfection studies:

    • Transfect cells (e.g., HeLa cells) with full-length ADAM23 cDNA

    • Assess adhesion properties of transfected cells

    • Analyze integrin dependency using function-blocking antibodies

    • Perform co-immunoprecipitation experiments to confirm physical interactions

  • Peptide mapping:

    • Design synthetic peptides corresponding to putative binding sequences in the disintegrin loop

    • Test peptides in competition assays to identify the minimal binding motif

    • Create point mutations in the binding sequence to determine critical residues

    • Note that ADAM23's interaction with αvβ3 occurs despite lacking the RGD motif common in other disintegrins

These approaches collectively provide a comprehensive analysis of the ADAM23-integrin αvβ3 interaction mechanism.

What are the most robust methods for investigating ADAM23 promoter methylation patterns in tumor samples?

Investigation of ADAM23 promoter methylation in tumor samples requires specialized epigenetic analysis techniques:

  • Bisulfite conversion and pyrosequencing:

    • Extract genomic DNA from fresh or formalin-fixed paraffin-embedded (FFPE) tumor tissues

    • Perform bisulfite conversion of DNA (converts unmethylated cytosines to uracils)

    • Design primers specific to the ADAM23 promoter region

    • Amplify the region of interest from bisulfite-modified DNA

    • Perform quantitative pyrosequencing to measure methylation levels at individual CpG sites

    • Calculate mean methylation levels across the analyzed region

  • Methylation-specific PCR (MSP):

    • Design primer pairs specific for methylated and unmethylated sequences after bisulfite conversion

    • Perform PCR reactions with both primer sets

    • Analyze products by gel electrophoresis to determine methylation status

    • Include appropriate positive and negative controls

  • Correlation with expression:

    • Perform immunohistochemistry (IHC) on the same tumor samples to detect ADAM23 protein expression

    • Identify representative tumor areas for analysis

    • Score expression levels semi-quantitatively

    • Correlate methylation levels with protein expression to establish functional significance

    • Analyze associations with clinical parameters (tumor stage, grade, patient survival)

  • Functional validation:

    • Treat cell lines with demethylating agents (e.g., 5-aza-2'-deoxycytidine)

    • Assess changes in ADAM23 expression by RT-qPCR and Western blotting

    • Evaluate phenotypic consequences (proliferation, migration, invasion)

These methodologies provide comprehensive characterization of ADAM23 methylation patterns and their functional significance in tumor biology.

How can researchers accurately assess the cardiac phenotypes in ADAM23 transgenic and knockout mouse models?

Comprehensive assessment of cardiac phenotypes in ADAM23 mouse models requires a multi-parameter approach:

  • Morphometric analysis:

    • Calculate heart weight/body weight (HW/BW) ratios

    • Determine heart weight/tibia length (HW/TL) ratios to normalize for potential differences in body size

    • Perform gross anatomical assessment of cardiac structures

  • Echocardiographic evaluation:

    • Measure left ventricle end-diastolic dimension (LVEDd)

    • Calculate fractional shortening (FS) to assess contractile function

    • Evaluate wall thickness and mass

    • Perform tissue Doppler imaging for diastolic function assessment

  • Histological analysis:

    • Prepare heart sections stained with:

      • Hematoxylin and eosin (H&E) for general morphology

      • Wheat germ agglutinin (WGA) for cardiomyocyte boundaries

      • Masson's trichrome or Sirius red for fibrosis

    • Measure cardiomyocyte cross-sectional area (CSA) from WGA-stained sections

    • Quantify perivascular and interstitial fibrosis area

  • Molecular characterization:

    • Analyze mRNA levels of hypertrophy markers including:

      • Atrial natriuretic peptide (Anp)

      • Brain natriuretic peptide (Bnp)

      • β-myosin heavy chain (β-Mhc)

    • Evaluate fibrosis markers:

      • Collagen I and III

      • Connective tissue growth factor (Ctgf)

  • Pressure overload response:

    • Subject mice to aortic banding (AB) surgery

    • Include appropriate sham-operated controls

    • Evaluate cardiac structure and function at defined timepoints (e.g., 4 weeks post-surgery)

    • Compare responses between genotypes

This comprehensive phenotyping approach provides robust assessment of ADAM23's role in cardiac pathophysiology.

What techniques are most effective for studying potential ADAM23-mediated cell adhesion in neurological disorders?

To investigate ADAM23-mediated cell adhesion in neurological contexts, researchers should employ these specialized techniques:

  • Cell-matrix adhesion assays:

    • Coat surfaces with purified recombinant ADAM23 disintegrin domain

    • Plate neural cells (neuroblastoma lines NB100, SH-SY5Y or astrocytoma lines U373, U87 MG)

    • Quantify adhesion by colorimetric or fluorescence-based methods

    • Perform competitive inhibition studies with specific antibodies or peptides

  • Integrin profiling:

    • Analyze integrin expression profiles of neural cells using flow cytometry

    • Focus particularly on αvβ3 integrin expression levels

    • Correlate expression with adhesion capability to ADAM23 substrates

    • Manipulate integrin expression levels and assess effects on ADAM23-mediated adhesion

  • Co-culture experiments:

    • Generate stable cell lines expressing ADAM23

    • Co-culture with neural cells expressing appropriate integrins

    • Assess cell-cell interactions through microscopy and aggregation assays

    • Evaluate the role of ADAM23 in these interactions using function-blocking antibodies

  • Ex vivo neural tissue studies:

    • Prepare brain slices from appropriate animal models

    • Apply recombinant ADAM23 or ADAM23-expressing cells

    • Analyze neural cell migration, adhesion, and neurite outgrowth

    • Compare responses between normal and disease models

  • In vivo models of neurological disorders:

    • Generate conditional ADAM23 knockout or overexpression in specific neural cell populations

    • Assess pathological outcomes in models of neurological disorders

    • Evaluate whether ADAM23-mediated adhesion contributes to disease progression or protection

These approaches provide a comprehensive framework for investigating ADAM23's role in neural cell adhesion in normal physiology and neurological disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.