ADAM23 (ADAM Metallopeptidase Domain 23) is a protein-coding gene located on chromosome 2. It encodes a member of the ADAM family involved in various biological processes including fertilization, muscle development, and neurogenesis . As a membrane-anchored protein, ADAM23 is structurally related to snake venom disintegrins, containing multiple functional domains that contribute to its diverse biological roles.
ADAM23 is well-characterized genetically, with consistent identifiers across multiple databases that facilitate research continuity and data integration.
| Identifier Type | ID |
|---|---|
| HGNC | 202 |
| NCBI Gene | 8745 |
| Ensembl | ENSG00000114948 |
| OMIM® | 603710 |
| UniProtKB/Swiss-Prot | O75077 |
| mRNA Refseq | NM_003812 |
| Protein Refseq | NP_003803 |
ADAM23 is a non-catalytic metalloprotease-like protein . Unlike some other members of the ADAM family, ADAM23 lacks proteolytic activity but retains important adhesive functions. The protein structure prediction from the Alphafold project includes one chain with 413 population variants identified . The Human Protein Atlas provides predicted structures from the Alphafold protein structure database and experimental structures from the Protein Data Bank (PDB), offering valuable insights into ADAM23's three-dimensional configuration .
Recombinant ADAM23 production predominantly utilizes bacterial expression systems. The disintegrin-like domain of ADAM23 has been successfully produced in Escherichia coli and used for functional studies demonstrating its cell adhesion properties . This expression system provides a cost-effective method for generating sufficient quantities of the protein for research applications.
The recombinant ADAM23 fragment (amino acids 621-710) has the following amino acid sequence:
GSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVED
Commercial preparations are typically formulated in 0.15 M Phosphate buffered saline and should be stored at -20 to -80°C for long-term stability, with recommendations to avoid repeated freeze-thaw cycles .
The disintegrin-like domain of ADAM23 demonstrates significant cell adhesion properties. When immobilized on culture dishes, recombinant ADAM23 promotes the attachment of various human cells of neural origin, including neuroblastoma cells (NB100 and SH-S y5 y) and astrocytoma cells (U373 and U87 MG) . This adhesion functionality suggests important roles in neural development and potentially in neural repair mechanisms.
ADAM23 exhibits a specific interaction with the αvβ3 integrin, mediated by a short amino acid sequence present in its putative disintegrin loop . Notably, this interaction occurs through an RGD-independent mechanism, distinguishing it from other disintegrins that typically rely on RGD motifs for αvβ3-mediated interactions . This unique binding mechanism expands our understanding of integrin-ligand interactions and suggests potential specificity in ADAM23's biological functions.
In cardiomyocytes, ADAM23 functions as a negative regulator of cardiac hypertrophy by inhibiting the focal adhesion kinase-protein kinase B (FAK-AKT) signaling pathway . This inhibitory effect on a major cellular signaling cascade demonstrates ADAM23's importance in maintaining cardiac homeostasis and preventing pathological cardiac remodeling.
ADAM23 is highly expressed in fetal and adult brain tissue, indicating important neurological functions . Recent research has established significant associations between ADAM23 and neurological disorders, particularly epilepsy. A gene-burden meta-analysis of 748,879 individuals identified ADAM23 as a novel candidate gene contributing to human epilepsy, potentially through its direct interaction with LGI1, a known epilepsy gene .
Research has identified ADAM23 as playing a critical role in cardiac health. Expression of ADAM23 is decreased in both failing human hearts and hypertrophic mice hearts, suggesting its involvement in cardiac pathology . Cardiac-specific conditional ADAM23-knockout mice exhibited exacerbated cardiac hypertrophy, fibrosis, and dysfunction, while transgenic mice overexpressing ADAM23 showed reduced cardiac hypertrophy in response to pressure overload . These findings position ADAM23 as a potential therapeutic target for cardiac hypertrophy.
The strong association between ADAM23 and epilepsy makes recombinant ADAM23 a valuable tool in neurological research. Its interaction with LGI1 provides a mechanistic pathway for investigating epileptogenesis . Phenome-wide analyses have highlighted that ADAM23 exhibits predominantly neurological effects, distinguishing it from other genes that show broader systemic involvement .
In cardiovascular studies, recombinant ADAM23 has been instrumental in investigating the mechanisms underlying cardiac hypertrophy. Research using recombinant ADAM23 has demonstrated that focal adhesion kinase inactivation by the inhibitor PF-562271 significantly reversed the detrimental effects observed in ADAM23-knockout mice subjected to aortic banding . These findings suggest that targeting the FAK-AKT pathway could be a promising therapeutic approach for cardiac hypertrophy.
The ability of recombinant ADAM23 to promote cell attachment through αvβ3 integrin interaction makes it a useful tool for studying cell adhesion mechanisms . This property has applications in cancer research, neurological studies, and investigations of cell migration and tissue organization. Researchers have demonstrated that HeLa cells transfected with a full-length cDNA for ADAM23 exhibit enhanced adhesion, extending the findings obtained with recombinant protein containing only the disintegrin domain .
Given its role as a negative regulator of cardiac hypertrophy and its association with epilepsy, ADAM23 represents a promising therapeutic target for both cardiovascular and neurological disorders . The development of ADAM23-targeting therapies could potentially provide new approaches for treating conditions like heart failure and epilepsy, where current treatment options remain suboptimal.
The association of ADAM23 with specific disease states suggests potential diagnostic applications. Detection of ADAM23 expression levels or identification of ADAM23 variants could serve as biomarkers for disease risk, progression, or response to therapy, particularly in epilepsy and cardiac conditions .
Cardiac-specific ADAM23 transgenic mice can be generated using a Cre-Lox conditional expression system. The methodology involves:
Obtaining the full-length cDNA for mouse ADAM23 by polymerase chain reaction (PCR)
Sequencing the cDNA to verify integrity
Inserting the cDNA into a pCAG-loxP-CAT-loxp-lacZ plasmid by replacing the LacZ gene
Generating the pCAG-CAT-mADAM23 plasmid containing the CAG promoter and LoxP-flanked CAT gene
Linearizing the transgene vector and microinjecting it into fertilized murine embryos (C57BL/6J)
Characterizing offspring genotypes via PCR on tail DNA samples
Breeding CAG-CAT-mADAM23 mice with α-MHC-MerCreMer mice to generate double-transgenic mice
Inducing Cre-mediated recombination with tamoxifen injection (25 mg/kg daily for five consecutive days)
This approach allows for temporal control of ADAM23 overexpression specifically in cardiomyocytes, enabling precise examination of its functional role in the heart.
Cardiac-specific ADAM23 knockout (cADAM23-KO) mice can be established using the CRISPR/Cas9 system through the following protocol:
Clone the exon 3 coding sequence region of mouse ADAM23 gene and flank it with two mLoxP sequences
Clone the recombinant DNA fragment into a vector containing homology arms (approximately 1153 and 1414 bp)
Design two single-guide RNAs targeting locations in the CDS region using online tools (http://crispr.mit.edu/)
Synthesize and validate sgRNAs for specificity and function in vitro
Inject Cas9 mRNA, sgRNAs, and donor vector into C57BL/6J mouse zygotes
Transplant injected zygotes into surrogate mother mice
Identify founder mice with floxed CDS regions on the same allele
Confirm floxed allele functionality through in vitro Cre/loxP-mediated recombination
Breed with cardiac-specific Cre-expressing mice to generate tissue-specific knockouts
This approach provides a powerful tool to study the loss-of-function effects of ADAM23 specifically in cardiac tissue, eliminating potentially confounding developmental effects from global knockout.
The preparation and manipulation of neonatal rat cardiomyocytes (NRCMs) for ADAM23 studies follows these methodological steps:
Harvest hearts from 1-day-old Sprague-Dawley rats
Excise, mince, and digest the tissue with trypsin
Pass digested tissue through a 40-μm cell strainer
Use differential attachment technique to remove fibroblasts
Seed cardiomyocytes in DMEM/F12 medium containing 20% fetal bovine serum, BrdU (to inhibit fibroblast proliferation), and antibiotics
For knockdown experiments, clone rat shADAM23 constructs into adenoviral vectors (using non-targeting AdshRNA as control)
For overexpression, subclone the entire coding region of rat ADAM23 gene under cytomegalovirus promoter control into adenoviral vectors (AdADAM23), using AdGFP as control
Infect cultured NRCMs with respective adenoviral constructs at a multiplicity of infection of 100 for 24 hours
Replace medium with DMEM/F12 containing 1% fetal bovine serum for 12 hours to synchronize cardiomyocytes
Stimulate cells with angiotensin II (1 μmol/L) or PBS (control) for 48 hours
This protocol enables reliable in vitro analysis of ADAM23 function in cardiomyocytes and is suitable for assessing hypertrophic responses through immunofluorescence staining and gene expression analysis.
For functional studies of the ADAM23 disintegrin-like domain, researchers can employ the following production and purification approach:
Design and synthesize expression constructs containing the disintegrin-like domain sequence
Express the recombinant protein in Escherichia coli expression systems
Optimize expression conditions (temperature, induction time, and IPTG concentration)
Lyse bacterial cells and solubilize the target protein
Perform affinity chromatography using appropriate tags (e.g., His-tag) for initial purification
Apply additional purification steps as needed (ion exchange, size exclusion chromatography)
Verify purity by SDS-PAGE and Western blotting
The purified disintegrin-like domain can then be immobilized on culture dishes to assess its ability to promote attachment of different human cells, particularly those of neural origin such as neuroblastoma cells (NB100, SH-SY5Y) or astrocytoma cells (U373, U87 MG).
Analysis of ADAM23 expression in tissue samples can be approached through multiple complementary techniques:
RT-qPCR Analysis:
Extract total RNA from tissue samples using standard protocols
Perform reverse transcription to generate cDNA
Design specific primers for human or mouse ADAM23
Quantify expression levels relative to appropriate housekeeping genes
Western Blot Analysis:
Extract proteins from tissue samples using appropriate lysis buffers
Separate proteins by SDS-PAGE and transfer to membranes
Probe with validated anti-ADAM23 antibodies
Visualize and quantify signals using appropriate detection systems
Immunohistochemistry (IHC):
Methylation Analysis (for epigenetic regulation):
These complementary approaches provide comprehensive analysis of ADAM23 expression at mRNA, protein, and epigenetic regulation levels.
To evaluate ADAM23's role in FAK/AKT signaling during cardiac hypertrophy, researchers should implement a multi-level experimental approach:
In vivo signaling analysis:
Subject ADAM23 transgenic and knockout mice to pressure overload via aortic banding (AB)
Harvest cardiac tissue at defined timepoints post-surgery
Prepare protein lysates and perform Western blot analysis for:
Phosphorylated and total FAK
Phosphorylated and total AKT
Downstream molecules: GSK3β and mTOR (both phosphorylated and total forms)
Compare expression and activation patterns between experimental groups
In vitro validation:
Pharmacological intervention:
Treat ADAM23-deficient mice with FAK inhibitors (e.g., PF-562271)
Evaluate the rescue of hypertrophic phenotypes through:
Heart weight/body weight ratios
Heart weight/tibia length ratios
Echocardiographic assessment
Histological analysis of cardiomyocyte size and fibrosis
This comprehensive approach allows for mechanistic understanding of how ADAM23 regulates cardiac hypertrophy through the FAK/AKT signaling pathway.
The investigation of ADAM23-integrin αvβ3 interactions requires specialized experimental designs:
Binding assays:
Express and purify the disintegrin-like domain of ADAM23
Immobilize the recombinant protein on plates or beads
Incubate with soluble purified integrins or cell lysates containing integrins
Detect interactions using specific antibodies
Perform competition assays with known integrin ligands to determine specificity
Cell adhesion assays:
Coat culture dishes with recombinant ADAM23 disintegrin-like domain
Plate various cell types (particularly neuroblastoma and astrocytoma cells)
Quantify cell attachment and spreading
Perform inhibition studies using:
Transfection studies:
Peptide mapping:
Design synthetic peptides corresponding to putative binding sequences in the disintegrin loop
Test peptides in competition assays to identify the minimal binding motif
Create point mutations in the binding sequence to determine critical residues
Note that ADAM23's interaction with αvβ3 occurs despite lacking the RGD motif common in other disintegrins
These approaches collectively provide a comprehensive analysis of the ADAM23-integrin αvβ3 interaction mechanism.
Investigation of ADAM23 promoter methylation in tumor samples requires specialized epigenetic analysis techniques:
Bisulfite conversion and pyrosequencing:
Extract genomic DNA from fresh or formalin-fixed paraffin-embedded (FFPE) tumor tissues
Perform bisulfite conversion of DNA (converts unmethylated cytosines to uracils)
Design primers specific to the ADAM23 promoter region
Amplify the region of interest from bisulfite-modified DNA
Perform quantitative pyrosequencing to measure methylation levels at individual CpG sites
Calculate mean methylation levels across the analyzed region
Methylation-specific PCR (MSP):
Design primer pairs specific for methylated and unmethylated sequences after bisulfite conversion
Perform PCR reactions with both primer sets
Analyze products by gel electrophoresis to determine methylation status
Include appropriate positive and negative controls
Correlation with expression:
Perform immunohistochemistry (IHC) on the same tumor samples to detect ADAM23 protein expression
Identify representative tumor areas for analysis
Score expression levels semi-quantitatively
Correlate methylation levels with protein expression to establish functional significance
Analyze associations with clinical parameters (tumor stage, grade, patient survival)
Functional validation:
Treat cell lines with demethylating agents (e.g., 5-aza-2'-deoxycytidine)
Assess changes in ADAM23 expression by RT-qPCR and Western blotting
Evaluate phenotypic consequences (proliferation, migration, invasion)
These methodologies provide comprehensive characterization of ADAM23 methylation patterns and their functional significance in tumor biology.
Comprehensive assessment of cardiac phenotypes in ADAM23 mouse models requires a multi-parameter approach:
Morphometric analysis:
Echocardiographic evaluation:
Histological analysis:
Prepare heart sections stained with:
Hematoxylin and eosin (H&E) for general morphology
Wheat germ agglutinin (WGA) for cardiomyocyte boundaries
Masson's trichrome or Sirius red for fibrosis
Measure cardiomyocyte cross-sectional area (CSA) from WGA-stained sections
Molecular characterization:
Pressure overload response:
This comprehensive phenotyping approach provides robust assessment of ADAM23's role in cardiac pathophysiology.
To investigate ADAM23-mediated cell adhesion in neurological contexts, researchers should employ these specialized techniques:
Cell-matrix adhesion assays:
Integrin profiling:
Co-culture experiments:
Generate stable cell lines expressing ADAM23
Co-culture with neural cells expressing appropriate integrins
Assess cell-cell interactions through microscopy and aggregation assays
Evaluate the role of ADAM23 in these interactions using function-blocking antibodies
Ex vivo neural tissue studies:
Prepare brain slices from appropriate animal models
Apply recombinant ADAM23 or ADAM23-expressing cells
Analyze neural cell migration, adhesion, and neurite outgrowth
Compare responses between normal and disease models
In vivo models of neurological disorders:
Generate conditional ADAM23 knockout or overexpression in specific neural cell populations
Assess pathological outcomes in models of neurological disorders
Evaluate whether ADAM23-mediated adhesion contributes to disease progression or protection
These approaches provide a comprehensive framework for investigating ADAM23's role in neural cell adhesion in normal physiology and neurological disease contexts.