Recombinant Human DNA damage-regulated autophagy modulator protein 2 (DRAM2)

Shipped with Ice Packs
In Stock

Description

Biological Functions

DRAM2 regulates autophagy initiation and lysosomal degradation pathways, with specific roles in:

  • Cellular Stress Response: Clears damaged organelles/proteins via autophagic-lysosomal pathways during DNA damage or oxidative stress .

  • Photoreceptor Maintenance: Facilitates retinal photoreceptor cell renewal by recycling visual cycle components .

  • Apoptosis Regulation: Synergizes with DRAM1 to induce programmed cell death under irreparable DNA damage .

Research Applications

This recombinant protein is widely used in:

Experimental Techniques

ApplicationRecommended DilutionKey Findings
Immunohistochemistry (IHC)1:20 – 1:200 Localizes DRAM2 in human retinal tissues .
Immunofluorescence (IF/ICC)1:50 – 1:200 Visualizes autophagosome formation in stressed HeLa cells .
Western BlotCustomized Detects endogenous DRAM2 in HEK-293 lysates .
ELISANot specified Quantifies DRAM2 expression in serum samples from autophagy-related diseases .

Functional Studies

  • Validates DRAM2’s interaction with AMPK/mTOR pathways in DNA repair .

  • Serves as a control fragment (aa 233-266) for antibody validation .

Expression Systems

HostPurityYieldUse Case
E. coli≥85%HighStructural studies
HEK-293 cells>90%ModeratePost-translational modification analysis
Cell-free systems (AliCE®)70-80%VariableRapid production of toxic proteins

Validation Metrics

  • Confirmed reactivity with human samples .

  • Batch-specific SDS-PAGE and SEC profiles .

Research Significance

Recent studies highlight DRAM2’s role in maintaining genomic stability:

  • DNA Repair: Autophagy-deficient cells exhibit increased error-prone NHEJ repair, linking DRAM2 to error-proof homologous recombination .

  • Cancer Relevance: Reduced DRAM2 levels correlate with chemoresistance in breast and prostate cancers due to impaired autophagy .

  • Aging: Accumulation of nuclear p62 (a DRAM2 interactor) with age disrupts RAD51 recruitment, exacerbating DNA damage .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
DRAM2; TMEM77; PSEC0031; UNQ154/PRO180; DNA damage-regulated autophagy modulator protein 2; Transmembrane protein 77
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
DRAM2
Target Protein Sequence
MWWFQQGLSFLPSALVIWTSAAFIFSYITAVTLHHIDPALPYISDTGTVAPEKCLFGAML NIAAVLCIATIYVRYKQVHALSPEENVIIKLNKAGLVLGILSCLGLSIVANFQKTTLFAA HVSGAVLTFGMGSLYMFVQTILSYQMQPKIHGKQVFWIRLLLVIWCGVSALSMLTCSSVL HSGNFGTDLEQKLHWNPEDKGYVLHMITTAAEWSMSFSFFGFFLTYIRDFQKISLRVEAN LHGLTLYDTAPCPINNERTRLLSRDI
Uniprot No.

Target Background

Function

DRAM2 plays a role in initiating autophagy. In the retina, it may be involved in photoreceptor cell renewal and recycling, contributing to visual function maintenance. Co-expression with DRAM1 can induce apoptotic cell death.

Gene References Into Functions

Selected Research Highlights on DRAM2:

  1. Mycobacterium tuberculosis significantly induces MIR144*/hsa-miR-144-5p expression, targeting the 3'-untranslated region of DRAM2. PMID: 27764573
  2. Genetic variants near the DRAM2 gene on chromosome 1p13.3 are associated with Non-ST Elevation Myocardial Infarction (rs656843; odds ratio 1.57, P = 3.11 x 10-10). PMID: 26509668
  3. Recessive DRAM2 variants, an autophagy regulator gene, cause retinal dystrophy with early macular involvement. PMID: 26720460
  4. Biallelic mutations in DRAM2 cause retinal dystrophy with early macular involvement. PMID: 25983245
  5. DRAM2 expression contributes to autophagy induction. PMID: 21584698
  6. Reduced DRAM2 expression may enhance cell survival in tumor cells. PMID: 19895784
  7. DRAM2 differs from DRAM; it's not induced by p53 or p73 and, as a lysosomal protein, its overexpression doesn't modulate autophagy. PMID: 19556885
Database Links

HGNC: 28769

OMIM: 613360

KEGG: hsa:128338

UniGene: Hs.485606

Protein Families
DRAM/TMEM150 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein. Photoreceptor inner segment. Apical cell membrane.
Tissue Specificity
Expression is down-regulated in ovarian tumors (at protein level). Widely expressed with highest levels in placenta and heart. Expressed in the retina. Not detected in brain or thymus.

Q&A

What is the basic structure of human DRAM2 protein?

DRAM2, also known as Transmembrane protein 77 (TMEM77), encodes a 266-amino acid protein with six putative transmembrane domains primarily localized in lysosomes . The protein was named after its homologue DRAM1, a key autophagy modulator and p53-cell death regulator, though DRAM2's cellular functions remain somewhat controversial . Structurally, DRAM2 contains multiple membrane-spanning regions that allow it to be embedded in lysosomal membranes, which is essential for its potential roles in autophagy and cellular degradation pathways.

How is DRAM2 expression distributed across human tissues?

DRAM2 demonstrates ubiquitous expression across human tissues rather than being restricted to specific cell types. Single-nucleus RNA sequencing analysis has revealed that DRAM2 is broadly expressed in the human eye, with detection in neurons (including photoreceptors, interneurons, and retinal ganglion cells), retinal pigment epithelium (RPE) cells, glial cells, mesenchymal cells, and myeloid cells . This non-specific expression pattern extends beyond the eye, as confirmed by single-cell transcriptomics datasets from 13 different tissues and blood samples, where DRAM2 was consistently expressed across various cell types . This ubiquitous expression suggests DRAM2 may serve fundamental cellular functions across multiple tissues.

What are the established functional roles of DRAM2?

DRAM2's function remains partially unclear, with research indicating involvement in several cellular processes. Studies have implicated DRAM2 in:

  • Cell death regulation: Multiple investigations have connected DRAM2 to cellular death pathways

  • Autophagy modulation: DRAM2 has demonstrated roles in autophagy processes, though the exact mechanisms remain under investigation

  • Inflammatory response: Recent studies have identified DRAM2's involvement in inflammation pathways

Most research on DRAM2 function has been conducted in the context of oncogenicity and tumor cell treatment response, rather than in neurodegeneration or retinal dystrophy contexts . This highlights the need for expanded functional characterization of this protein in diverse physiological and pathological contexts.

What genetic modification techniques are most effective for DRAM2 knockout or knockdown?

Several approaches have proven effective for modifying DRAM2 expression in research settings:

CRISPR/Cas9 Knockout in Human Cell Lines:
For generating DRAM2 knockout (KO) human pluripotent stem cell (hPSC) lines, guide RNAs targeting DRAM2 exon3 (5′-AAGGTAAAGCCGGGTCTATA) have been successfully employed . The procedure involves:

  • Trypsinizing hPSCs to single cells

  • Electroporating with gRNA and rCas9 protein using Human Amaxa P3 Primary Cell Nucleofector Kit

  • Plating cells onto Matrigel-coated plates with mTeSR1 PLUS medium containing ROCK inhibitor

  • Colony selection after 10 days

  • Screening clones via genomic DNA isolation, PCR amplification, and sequence verification

Lentiviral shRNA Knockdown:
For gene knockdown applications, shRNAs targeting DRAM2 in lentiviral vectors (e.g., pGIPZ-CMV-tGFP-IRES-puro) have demonstrated approximately 10-fold knockdown efficiency . The protocol involves:

  • Transfecting HEK 293T cells with lentiviral vectors alongside packaging plasmids

  • Harvesting viral supernatants after 72 hours

  • Infecting target cells for 48 hours

  • Confirming knockdown efficiency via qRT-PCR

What in vitro models are most suitable for studying DRAM2 function?

Research has validated several complementary in vitro models for investigating DRAM2 function:

Retinal Organoids:
Human pluripotent stem cell-derived retinal organoids provide a complex 3D environment that contains most retinal cell types . These can be generated from DRAM2 knockout or wildtype hPSCs through directed differentiation protocols that yield:

  • Eye cups expressing early RPE and neural retina markers after 1 month

  • Three-dimensional organoids with photoreceptor progenitor cells at 2 months

  • Mature rod and cone photoreceptors at 5 months

This system allows for long-term maturation (up to 12 months) and single-cell RNA sequencing analysis to examine cellular composition and gene expression patterns.

RPE Cell Models:
Two complementary approaches have been validated for studying DRAM2 in RPE contexts:

  • Lentivirus-shRNA knockdown in human primary RPE cells (hRPE)

  • CRISPR/Cas9 knockout in human pluripotent stem cell-derived RPE cells (hPSC-RPE)

Both systems allow for full differentiation and functional testing, including phagocytosis assays and stress response evaluations using toxins like A2E or sodium iodate.

How can I validate DRAM2 knockout or knockdown efficiency?

Multiple validation approaches have been established:

Genomic DNA Validation:

  • Isolate genomic DNA using Puregene Cell Kit or equivalent

  • PCR amplify with primers flanking the target region

  • Clone PCR products into a T-vector

  • Sequence to confirm modifications

Transcript Level Validation:

  • Isolate RNA using RNeasy Plus Mini RNA Isolation kit

  • Reverse-transcribe using High-Capacity cDNA Reverse Transcription kit

  • Perform qRT-PCR with DRAM2-specific primers:

    • Forward: 5′-TCAGCAAGGCCTCAGTTTCC

    • Reverse: 5′-GTAGCAATGCATAAAACTGCCG

  • Normalize to housekeeping gene (GAPDH) and then to expression in control cells

Protein Level Validation:
Note that identifying highly specific anti-DRAM2 antibodies has proven challenging, with research indicating difficulties in finding antibodies with satisfactory specificity profiles .

What is known about DRAM2's role in retinal dystrophy?

DRAM2 variants causing putative loss of function have been associated with retinal dystrophy in multiple studies . Clinical presentations typically include:

  • Symptom onset in the early third decade of life

  • Maculopathy and progressive central visual loss

  • Various forms of retinal degeneration

Research using DRAM2 knockout models has revealed increased vulnerability of retinal cells to stress-induced death, suggesting protective functions of DRAM2 in normal retinal physiology. The exact mechanisms underlying retinal degeneration in DRAM2-deficient conditions remain under investigation, but likely involve altered stress responses and cell survival pathways.

How does DRAM2 expression change in Age-related Macular Degeneration (AMD)?

Analysis of bulk RNA sequencing data from human donor eyes has revealed that DRAM2 expression is slightly but significantly lower in AMD retinas and RPE/Choroids compared to non-AMD controls (p < 0.05 and p < 0.01, respectively) . This decrease does not appear to be simply a consequence of photoreceptor or RPE cell loss, as no significant correlation was found between DRAM2 expression and cell-type markers like RCVRN (photoreceptors) or BEST1 (RPE cells) . In situ hybridization studies in advanced dry AMD donor eyes showed DRAM2 mRNA detected sparsely in all retinal layers, with relatively abundant signal in a few cells in the choriocapillaris where RPE was destroyed in AMD lesions .

How does DRAM2 deficiency affect cellular stress responses?

DRAM2 appears to play a protective role against cellular stressors, particularly in retinal pigment epithelium cells. Experimental evidence shows:

In human primary RPE cells with DRAM2 knockdown:

  • Accelerated cell death following A2E treatment (median survival reduction from 126h to 102-114h)

  • Increased vulnerability to sodium iodate toxicity (median survival reduction from 118h to 64-78h)

In hPSC-derived RPE cells with DRAM2 knockout:

  • Significantly reduced survival after A2E treatment (median survival reduction from 72h to 42-50h)

  • Enhanced sensitivity to sodium iodate (median survival reduction from 86h to 34h)

These findings indicate DRAM2 plays an important role in cellular resilience against toxicity-induced cell death, potentially through autophagy regulation or other cellular protective mechanisms.

What are the optimal conditions for expressing recombinant human DRAM2?

While the search results don't provide specific protocols for recombinant DRAM2 expression, general principles for membrane protein expression can be applied, with modifications based on DRAM2's characteristics:

Expression System Considerations:

  • Mammalian expression systems (HEK293, CHO cells) are likely preferable given DRAM2's six transmembrane domains

  • Codon optimization for the expression host may improve yields

  • Addition of N-terminal signal sequences and C-terminal purification tags (avoiding disruption of transmembrane domains)

  • Inducible expression systems to mitigate potential toxicity

Purification Approach:

  • Detergent screening (starting with mild non-ionic detergents like DDM or LMNG)

  • Affinity chromatography followed by size exclusion chromatography

  • Consider lipid supplementation during purification to maintain stability

Validation of properly folded recombinant DRAM2 would require functional assays, potentially including liposome reconstitution experiments to assess membrane integration.

What experimental approaches can distinguish between DRAM2's roles in autophagy versus cell death?

Disentangling DRAM2's functions requires multi-faceted experimental approaches:

Autophagy Assessment:

  • Autophagy flux monitoring using tandem fluorescent LC3 (mRFP-GFP-LC3) in DRAM2 KO vs. WT cells

  • Quantification of autophagosomes and autolysosomes via electron microscopy

  • Western blot analysis of autophagy markers (LC3-II/LC3-I ratio, p62/SQSTM1 levels)

  • Co-localization studies of DRAM2 with autophagy machinery components

  • Rescue experiments with autophagy modulators in DRAM2-deficient cells

Cell Death Pathway Analysis:

  • Flow cytometry with Annexin V/PI staining to distinguish apoptosis from necrosis

  • Caspase activation assays (caspase-3/7, -8, -9 activity)

  • MLKL phosphorylation assessment for necroptosis

  • Gasdermin D cleavage analysis for pyroptosis

  • Pharmacological inhibition of specific death pathways to identify rescue effects

Interaction Studies:

  • Proximity labeling techniques (BioID, APEX) to identify DRAM2 interaction partners

  • Co-immunoprecipitation with known autophagy and cell death components

  • Subcellular fractionation to assess DRAM2 redistribution during stress conditions

What techniques are most effective for analyzing DRAM2 interaction with the autophagy machinery?

Building on established approaches in autophagy research:

Protein-Protein Interaction Analysis:

  • Co-immunoprecipitation of DRAM2 with autophagy proteins (limitations due to antibody specificity issues noted)

  • Proximity-dependent biotin labeling (BioID or TurboID fused to DRAM2)

  • FRET/BRET analysis with fluorescently tagged DRAM2 and key autophagy components

  • Mammalian two-hybrid screening to identify direct interactors

Subcellular Co-localization:

  • Super-resolution microscopy (STORM, PALM) with dual labeling of DRAM2 and autophagy markers

  • Live-cell imaging with tagged DRAM2 during autophagy induction

  • Immunogold electron microscopy to precisely localize DRAM2 relative to autophagic structures

  • Correlative light and electron microscopy (CLEM) for comprehensive localization analysis

Functional Analysis:

  • Autophagy assays in DRAM2 KO cells reconstituted with structure-function mutants

  • Chemical crosslinking followed by mass spectrometry (XL-MS) to map interaction interfaces

  • in vitro reconstitution systems using purified components to test direct effects on autophagosome formation

How do DRAM1 and DRAM2 functions compare and potentially overlap?

While the search results primarily focus on DRAM2, understanding its relationship to DRAM1 provides important context:

DRAM1 is a well-established autophagy modulator and p53-cell death regulator . Despite their homology, DRAM2's functional relationship to DRAM1 remains incompletely characterized. Key considerations for comparative research include:

  • Structural comparison of transmembrane domains and potential functional motifs

  • Analysis of differential expression patterns across tissues and disease states

  • Investigation of potential redundancy through double knockout approaches

  • Examination of transcriptional regulation differences, particularly regarding p53 responsiveness

  • Comparative interactome mapping to identify shared and unique protein partners

Rescue experiments testing whether DRAM1 overexpression can compensate for DRAM2 deficiency (and vice versa) would provide valuable insights into functional overlap.

What is known about DRAM2 conservation across species?

Though not extensively covered in the search results, the availability of mouse models indicates DRAM2 conservation in mammals. Researchers should consider:

  • Comparative sequence analysis across vertebrate species to identify highly conserved domains

  • Analysis of expression patterns in model organisms to determine conservation of tissue distribution

  • Functional studies in evolutionary distant models to assess conservation of cellular roles

  • Examination of regulatory elements to understand evolutionary constraints on expression

Understanding evolutionary conservation provides critical context for interpreting experimental findings across different model systems and extrapolating to human biology.

What are the current technical limitations in DRAM2 research?

Several technical challenges have been identified in DRAM2 research:

Antibody Specificity Issues:
A significant limitation has been the lack of anti-DRAM2 antibodies with satisfactory specificity profiles . This challenges protein-level detection and localization studies, restricting analyses primarily to mRNA expression or tagged recombinant proteins.

Complex Model Systems:
While retinal organoids provide valuable 3D systems, they exhibit inherent variability in shape and size , potentially confounding phenotypic analyses and requiring larger sample sizes for statistical power.

Functional Redundancy:
The ubiquitous expression of DRAM2 across multiple cell types suggests potential functional redundancy with related proteins, which may mask phenotypes in knockout models and complicate functional characterization.

What are the most promising therapeutic applications for modulating DRAM2 function?

Based on current understanding, several therapeutic directions merit investigation:

Retinal Disease Applications:

  • DRAM2 enhancement strategies could potentially protect against retinal cell death in AMD or other degenerative eye conditions

  • Considering DRAM2's protective effects against toxicity-induced RPE cell death , its modulation might offer therapeutic benefits in macular degeneration

Autophagy Modulation:

  • If DRAM2's role in autophagy is further established, targeting this function could have applications in neurodegenerative diseases characterized by protein aggregation

  • Fine-tuning autophagy through DRAM2 modulation might offer advantages over broader autophagy modulators

Cell Death Regulation:

  • Enhancing DRAM2 function could potentially protect vulnerable cells from stress-induced death

  • Alternatively, inhibiting DRAM2 might sensitize cancer cells to treatment, depending on context

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.