Recombinant Human DnaJ homolog subfamily C member 14 (DNAJC14)

Shipped with Ice Packs
In Stock

Description

General Information

DnaJ homolog subfamily C member 14, also known as DNAJC14, is a protein that in humans is encoded by the DNAJC14 gene . DNAJC14 is also known as DRIP78, HDJ3, and LIP6 . It functions as a regulator for the export of specific proteins, such as DRD1 (dopamine receptor D1), moving them from the endoplasmic reticulum to the cell surface .

  • Official Full Name (NCBI): DnaJ heat shock protein family (Hsp40) member C14

  • Official Symbol (NCBI): DNAJC14

  • Protein type: Endoplasmic reticulum; Chaperone; Membrane protein, integral; Membrane protein, multi-pass

  • Molecular Function: Dopamine receptor binding

  • Biological Process: Protein transport

  • Chromosomal Location of Human Ortholog: 12q13.2

Protein Structure and Function

DNAJC14 is a member of the DnaJ/Hsp40 family of proteins, which are co-chaperones of Hsp70 proteins . These proteins participate in a wide array of cellular processes, including protein folding, trafficking, and degradation . DNAJC14 contains a J domain, which is a characteristic feature of DnaJ proteins that interacts with Hsp70 chaperones .

DNAJC14 is an endoplasmic reticulum (ER) membrane protein with its NH2 and COOH termini and major functional domains, including the J domain, exposed to the cytosol . This structural characteristic suggests that transmembrane proteins synthesized in the ER may be substrates of DNAJC14 during ER-to-Golgi blockade or ER stress conditions .

Role in Protein Trafficking

DNAJC14 plays a role in regulating the cell-surface trafficking of the dopamine D1 receptor, SNARE complex-mediated lysosomal trafficking, and specific membrane targeting of yellow fever virus replication proteins . It modulates the function of Hsc70, diverting substrate proteins from proteasomal degradation to cell-surface secretion .

Interaction with Hsc70

DNAJC14 interacts with Hsc70, a constitutively expressed molecular chaperone . Under conditions of DNAJC14 upregulation, such as during ER stress or in cells overexpressing exogenous DNAJC14, the J protein DNAJC14 may bind to the client protein and bring it to the ATP-bound form of Hsc70 .

Involvement in Unconventional Secretion of Pendrin

DNAJC14 participates in the unconventional secretion of pendrin, an anion exchanger involved in chloride and iodide transport . It has been shown that knockdown of DNAJC14 has the strongest effect in reducing the unconventional secretion of H723R-pendrin . DNAJC14 alone increased the Cl−/HCO3− exchange activity of H723R-expressing PANC-1 cells .

Research Findings

Role in Pendrin SecretionDNAJC14 is involved in the unconventional secretion of H723R-pendrin. When Hsc70 and DNAJC14 were simultaneously depleted, the Arf1-Q71L-induced cell-surface expression of H723R-pendrin was almost completely abolished .
Functional AssaysDNAJC14 alone increased the Cl−/HCO3− exchange activity of H723R-expressing PANC-1 cells from 0.039±0.015 ΔpH unit min −1 to 0.201±0.034 ΔpH unit min −1 (P<0.01) .
Pestivirus DependencyNoncp pestiviruses depend on DNAJC14 for their replication. Infection of MDBK or SK6 DNAJC14-KO cells with different noncp pestivirus isolates did not result in detectable virus replication at 72 hpi for any of these tested noncp virus isolates .
APPV ReplicationAPPV replication is independent of DNAJC14. After electroporation of recAPPV-wt RNA into the DNAJC14 knockout cell line, regular replication and protein expression were detected .
Subcellular LocalizationOverexpression of DNAJC14 leads to its distribution both within the ER and in multiple cytosolic punctate structures, where it colocalized with Hsc70 .
Interaction with Rab18Overexpressed DNAJC14 colocalized with Rab18, which is considered to be a marker of lipid droplets .
Regulation of Target ProteinsDNAJC14 regulates the export of target proteins, such as DRD1, from the endoplasmic reticulum to the cell surface .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing. If a specific tag type is required, please specify it during ordering; we will prioritize fulfilling such requests.
Synonyms
DNAJC14; DRIP78; HDJ3; DnaJ homolog subfamily C member 14; DnaJ protein homolog 3; Dopamine receptor-interacting protein of 78 kDa; Human DnaJ protein 3; hDj-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-702
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
DNAJC14
Target Protein Sequence
MAQKHPGERGLYGAHHSGGASLRTLGPSVDPEIPSFSGLRDSAGTAPNGTRCLTEHSGPK HTQHPNPAHWLDPSHGPPGGPGPPRDAEDPDQSETSSEEESGVDQELSKENETGNQKDGN SFLSIPSACNCQGTPGIPEGPYSEGGNGSSSNFCHHCTSPALGEDELEEEYDDEESLKFP SDFSRVSSGKKPPSRRQRHRFPTKEDTREGGRRDPRSPGRHRLGRKRSQADKRKGLGLWG AEELCQLGQAGFWWLIELLVLVGEYVETCGHLIYACRQLKSSDLDLFRVWMGVWTGRLGG WAQVMFQFLSQGFYCGVGLFTRFLKLLGALLLLALALFLGFLQLGWRFLVGLGDRLGWRD KATWLFSWLDSPALQRCLTLLRDSRPWQRLVRIVQWGWLELPWVKQNINRQGNAPVASGR YCQPEEEVARLLTMAGVPEDELNPFHVLGVEATASDVELKKAYRQLAVMVHPDKNHHPRA EEAFKVLRAAWDIVSNAEKRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSRC QGKHRRFEMDREPKSARYCAECNRLHPAEEGDFWAESSMLGLKITYFALMDGKVYDITEW AGCQRVGISPDTHRVPYHISFGSRIPGTRGRQRATPDAPPADLQDFLSRIFQVPPGQMPN GNFFAAPQPAPGAAAASKPNSTVPKGEAKPKRRKKVRRPFQR
Uniprot No.

Target Background

Function
Recombinant Human DNAJC14 regulates the trafficking of target proteins, such as DRD1, from the endoplasmic reticulum to the cell surface.
Gene References Into Functions
  1. Hsc70 and DNAJC14 are essential for the unconventional trafficking of H723R-pendrin. PMID: 27109633
  2. DNAJC14's folding activity modulates yellow fever virus NS3/4A/2K cleavage, impacting NS3 and NS4A release and replication complex formation. PMID: 26739057
  3. DRiP78, a molecular chaperone, interacts with CXCR4 and CCR5 individually, but not with their heterodimer. PMID: 22815758
  4. DNAJC14 and yellow fever virus replication proteins exhibit membrane-targeted activity. PMID: 22915803
  5. DNAJC14 is critical for yellow fever virus replication. PMID: 21249176
Database Links

HGNC: 24581

OMIM: 606092

KEGG: hsa:85406

STRING: 9606.ENSP00000316240

UniGene: Hs.709320

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in pancreas and selectively expressed in brain, lung, liver, skeletal muscle and kidney.

Q&A

What are the known cellular functions of DNAJC14 in normal physiology?

In normal cellular physiology, DNAJC14 functions as a co-chaperone protein that assists in protein folding, trafficking, and quality control mechanisms. It interacts with heat shock protein 70 (Hsp70) to facilitate proper protein folding and prevent protein aggregation during cellular stress responses.

Additionally, DNAJC14 has been identified as:

  • A dopamine receptor-interacting protein (DRIP78), suggesting a role in neurotransmitter receptor regulation

  • A component involved in intracellular protein transport pathways

  • A participant in quality control mechanisms for membrane proteins

How does recombinant DNAJC14 differ from native cellular DNAJC14?

Recombinant human DNAJC14 proteins produced for research purposes may differ from native cellular DNAJC14 in several key aspects:

  • Post-translational modifications: Recombinant DNAJC14 produced in bacterial or in vitro cell-free systems may lack the post-translational modifications (phosphorylation, glycosylation) present in native mammalian DNAJC14 .

  • Structural conformation: The folding and tertiary structure of recombinant DNAJC14 may not perfectly match the native protein, particularly if expressed in non-mammalian systems.

  • Fusion tags: Many commercial recombinant DNAJC14 preparations include fusion tags (His, Fc, Myc/DDK, etc.) that facilitate purification but are not present in the native protein .

  • Expression level: Recombinant systems typically produce DNAJC14 at significantly higher concentrations than found in normal cells, which may affect functional studies.

  • Purity and homogeneity: Recombinant preparations are typically more homogeneous than native protein isolates, lacking the interacting partners and protein complexes found in cellular contexts.

When designing experiments with recombinant DNAJC14, researchers should consider these differences, particularly when interpreting functional results that may be influenced by these variations from the native protein.

What is the role of DNAJC14 in pestiviral replication cycles?

DNAJC14 serves as an essential host cofactor for the replication of most pestiviruses, acting through a specific mechanism involving viral polyprotein processing. The protein functions as a critical regulator of the NS2 autoprotease activity in pestiviruses, which is essential for the release of mature NS3 protein and subsequent viral RNA replication .

Key aspects of DNAJC14's role in pestiviral replication include:

  • NS2 autoprotease activation: DNAJC14, particularly its Jiv90 domain, activates the NS2 cysteine autoprotease of pestiviruses, enabling the cleavage at the NS2-3 junction and release of mature NS3 .

  • Regulation of viral RNA replication: By controlling NS3 release, DNAJC14 effectively regulates viral RNA replication levels. Limited availability of DNAJC14 in host cells restricts NS3 release, keeping viral replication at moderate, non-cytopathogenic levels .

  • Biotype determination: DNAJC14 availability is linked to the distinction between cytopathogenic (cp) and non-cytopathogenic (non-cp) pestivirus biotypes. Non-cp pestiviruses depend on DNAJC14 for replication, while cp pestiviruses have evolved mechanisms to generate NS3 independently of DNAJC14 .

This understanding has been confirmed through CRISPR/Cas9-mediated knockout studies of DNAJC14, which demonstrated that non-cp pestiviruses cannot replicate in DNAJC14-deficient cells, while cp pestiviruses remain unaffected .

Interestingly, the Atypical Porcine Pestivirus (APPV) represents a notable exception to this rule. Research has shown that APPV can replicate efficiently in DNAJC14 knockout cells, suggesting it utilizes a divergent mechanism for NS2-3 processing that is independent of DNAJC14 .

How does DNAJC14 exhibit antiviral activity against flaviviruses?

DNAJC14 has been identified as having significant antiviral activity against certain flaviviruses, particularly yellow fever virus (YFV). When overexpressed, DNAJC14 can mediate protection from YFV-induced cell death .

The antiviral mechanism of DNAJC14 against flaviviruses appears to be distinct from its role in pestivirus replication:

  • Inhibition of viral replication complex formation: Overexpressed DNAJC14 may interfere with the proper assembly of viral replication complexes, preventing efficient viral RNA synthesis.

  • Modulation of membrane structures: DNAJC14 may alter the formation of virus-induced membrane structures that are essential for flavivirus replication.

  • Protein folding interference: As a chaperone protein, DNAJC14 may affect the folding and maturation of viral proteins required for replication.

This dual role—acting as an essential cofactor for most pestiviruses while inhibiting certain flaviviruses—makes DNAJC14 a particularly interesting target for understanding virus-host interactions within the broader Flaviviridae family.

What are the consequences of DNAJC14 knockout on cellular functions and viral susceptibility?

CRISPR/Cas9-mediated knockout of DNAJC14 has provided valuable insights into both its cellular functions and role in viral infections . The consequences of DNAJC14 knockout include:

Effects on viral susceptibility:

  • Pestivirus resistance: DNAJC14 knockout cells become resistant to infection with non-cytopathogenic (non-cp) pestivirus strains, confirming DNAJC14's essential role in their replication cycle .

  • Biotype-specific effects: While non-cp pestiviruses cannot replicate in DNAJC14 knockout cells, cytopathogenic (cp) pestiviruses remain capable of replication, highlighting a fundamental difference in replication strategies .

  • APPV exception: Atypical porcine pestivirus (APPV) can replicate efficiently in DNAJC14 knockout cells, unlike other non-cp pestiviruses, revealing its unique independence from this host factor .

Effects on cellular functions:

  • Viability: DNAJC14 knockout cells remain viable, indicating that the protein is not essential for basic cellular survival under standard culture conditions.

  • Protein homeostasis: Loss of DNAJC14 may alter cellular protein quality control mechanisms, potentially affecting the folding and trafficking of certain cellular proteins.

  • Stress responses: DNAJC14-deficient cells may exhibit altered responses to various cellular stresses, particularly those involving protein folding challenges.

The generation of DNAJC14 knockout cell lines using CRISPR/Cas9 technology has proven to be an invaluable tool for studying both the fundamental cellular functions of this chaperone and its specific roles in viral infection processes .

What are the optimal expression systems for producing functional recombinant human DNAJC14?

The choice of expression system significantly impacts the functionality, yield, and properties of recombinant human DNAJC14. Based on research applications, several systems have demonstrated effectiveness:

Mammalian expression systems:

  • HEK293 cells: Provide proper post-translational modifications and folding, yielding highly functional DNAJC14 most similar to the native protein.

  • CHO cells: Offer good scalability while maintaining proper protein processing.

In vitro cell-free systems:

  • These systems have been successfully used to produce full-length human DNAJC14, as indicated in the search results .

  • Advantages include rapid production and avoidance of cell toxicity issues.

E. coli-based systems:

  • Suitable for expressing functional domains like the Jiv90 fragment rather than the full-length protein.

  • Higher yield but may lack proper folding and post-translational modifications.

Expression considerations:

  • Fusion tags: His, Fc, or Avi tags can facilitate purification but may affect protein function. Tag removal options should be incorporated into construct design for functional studies.

  • Storage conditions: Recombinant DNAJC14 is typically most stable when stored at -80°C in buffer containing 25 mM Tris-HCl (pH 8.0) with 2% glycerol .

  • Expression verification: Western blotting and functional assays should be employed to confirm proper expression and activity.

For maximal functionality in applications studying virus-host interactions, mammalian expression systems typically yield the most physiologically relevant recombinant DNAJC14 proteins.

How can researchers validate the functionality of recombinant DNAJC14 in experimental settings?

Validating the functionality of recombinant DNAJC14 is crucial for experimental reliability. Several complementary approaches can be employed:

Biochemical validation:

  • Protein folding assessment: Circular dichroism (CD) spectroscopy to evaluate secondary structure elements characteristic of properly folded DNAJC14.

  • Thermal stability analysis: Differential scanning fluorimetry (DSF) to assess protein stability and folding status.

  • Size exclusion chromatography: To confirm the protein exists in the expected oligomeric state and is not aggregated.

Functional validation:

  • Pestivirus NS2 autoprotease activation assay: Measuring the ability of recombinant DNAJC14 to activate the NS2 autoprotease in a cell-free system, with detection of NS2-3 cleavage products by Western blotting .

  • Complementation assay in DNAJC14 knockout cells: Transfection of recombinant DNAJC14 into DNAJC14-deficient cells should restore susceptibility to non-cp pestivirus infection .

  • Antiviral activity assessment: Testing whether overexpression of the recombinant DNAJC14 can protect cells from yellow fever virus (YFV)-induced cytopathic effects .

Interaction validation:

  • Co-immunoprecipitation: Verifying the ability of recombinant DNAJC14 to interact with known binding partners, including viral NS2 protein or cellular Hsp70.

  • Surface plasmon resonance: Quantitatively measuring binding affinities between recombinant DNAJC14 and interaction partners.

The validation approach should be tailored to the specific research question and the intended use of the recombinant DNAJC14 protein.

What techniques are most effective for studying DNAJC14-virus interactions?

Several specialized techniques have proven particularly effective for investigating DNAJC14 interactions with viral components:

Cellular and molecular techniques:

  • CRISPR/Cas9 gene editing: Generation of DNAJC14 knockout cell lines provides a clean background for studying the necessity of DNAJC14 in viral replication . The approach has successfully demonstrated that non-cp pestiviruses cannot replicate in DNAJC14-deficient cells.

  • Inducible expression systems: Tetracycline-inducible DNAJC14 expression systems allow precise control over protein levels, enabling dose-response studies of DNAJC14's effect on viral replication.

  • Fluorescence-based viral replication assays: Using reporter viruses expressing fluorescent proteins to quantitatively measure how different levels or variants of DNAJC14 affect viral replication kinetics.

Protein interaction studies:

  • Co-immunoprecipitation with viral components: Using tagged versions of DNAJC14 to pull down interacting viral proteins, particularly NS2 and NS3 proteins from pestiviruses.

  • Proximity labeling approaches: BioID or APEX2 fusion proteins to identify proteins in close proximity to DNAJC14 during viral infection.

  • Confocal microscopy: Visualizing the co-localization of fluorescently tagged DNAJC14 with viral replication complexes.

Structural analysis:

  • Cryo-electron microscopy: Resolving structures of DNAJC14 in complex with viral proteins to understand binding interfaces.

  • Hydrogen-deuterium exchange mass spectrometry: Mapping interaction surfaces between DNAJC14 and viral components.

  • Mutational analysis: Systematic mutation of DNAJC14 domains to identify regions critical for specific viral interactions.

As demonstrated in research with APPV, combining reverse genetics of viral genomes with cellular knockout systems provides particularly powerful insights into the role of DNAJC14 in viral replication mechanisms .

How can recombinant DNAJC14 be used to develop antiviral strategies?

Recombinant DNAJC14 offers several promising avenues for developing novel antiviral strategies against members of the Flaviviridae family:

Therapeutic approaches based on DNAJC14's dual role:

  • Viral dependency targeting: For viruses dependent on DNAJC14 (non-cp pestiviruses), compounds that disrupt the interaction between DNAJC14 and viral NS2 could inhibit viral replication .

  • Antiviral activity enhancement: For flaviviruses inhibited by DNAJC14 (like YFV), developing peptides or small molecules that mimic the antiviral activity of DNAJC14 could provide therapeutic benefits .

Research applications:

  • High-throughput screening platforms: Using recombinant DNAJC14 in binding assays to screen for compounds that either enhance or disrupt its interaction with viral proteins.

  • Structure-based drug design: Utilizing structural information about DNAJC14-viral protein complexes to design targeted therapeutics that modulate these interactions.

  • Gene therapy approaches: Exploring controlled overexpression of DNAJC14 or its functional domains as an antiviral strategy against susceptible flaviviruses.

Diagnostic potential:

  • Biomarker development: Changes in DNAJC14 levels or modifications during viral infections could serve as diagnostic markers.

  • Virus typing: The differential dependency on DNAJC14 among pestiviruses (including the APPV exception) could be exploited for diagnostic classification of viral isolates .

The unique finding that APPV can replicate independently of DNAJC14 while other pestiviruses cannot provides an important comparative model for understanding essential virus-host interactions that could be targeted therapeutically .

What insights does DNAJC14 research provide about viral biotypes and pathogenesis?

Research on DNAJC14 has revealed critical insights into viral biotypes and pathogenesis, particularly for pestiviruses:

Biotype determination mechanisms:

  • Non-cp versus cp biotype distinction: DNAJC14 dependency represents a fundamental molecular distinction between non-cytopathogenic (non-cp) and cytopathogenic (cp) pestiviruses. Non-cp strains rely on limited cellular DNAJC14 levels to control NS2-3 processing and maintain moderate replication levels, while cp strains have evolved mechanisms for DNAJC14-independent NS3 release .

  • Evolutionary transitions: The cp biotype often emerges from non-cp viruses through genomic alterations that bypass DNAJC14 dependency, providing insights into viral evolution under selective pressure .

Pathogenesis implications:

  • Persistent infection establishment: The DNAJC14-dependent regulation of non-cp pestivirus replication is critical for establishing life-long persistent infections, which form the virus reservoir in the field .

  • Mucosal disease pathogenesis: The development of cp BVDV in persistently infected animals triggers mucosal disease, a lethal condition. The switch from DNAJC14 dependency to independence may be central to this pathogenic conversion .

  • Tissue tropism determinants: Differential expression of DNAJC14 across tissues may influence viral tropism and contribute to tissue-specific pathology.

Comparative virology insights:

  • Evolutionary adaptations: The finding that APPV can replicate efficiently without DNAJC14 suggests alternative evolutionary strategies within the pestivirus genus .

  • Host range factors: DNAJC14 dependency may represent a host range restriction factor for certain pestiviruses.

These insights demonstrate how studying virus-host factor interactions, particularly with DNAJC14, provides fundamental knowledge about viral pathogenesis mechanisms and potential targets for intervention.

How does APPV's DNAJC14-independent replication mechanism differ from other pestiviruses?

The discovery that Atypical Porcine Pestivirus (APPV) can replicate independently of DNAJC14 represents a significant divergence from other pestiviruses and provides valuable comparative insights:

Mechanistic differences:

  • NS2-3 processing regulation: While classical pestiviruses rely on DNAJC14 to activate the NS2 autoprotease for NS2-3 cleavage, APPV must employ an alternative mechanism or cellular cofactor to regulate this essential processing step .

  • Experimental evidence: Research has demonstrated that APPV replicates efficiently in DNAJC14 knockout cells, while control experiments with classical swine fever virus (CSFV) showed no replication in these same cells .

  • Response to DNAJC14 overexpression: Unlike classical pestiviruses, APPV replication is not enhanced by overexpression of DNAJC14 (Jiv90), and no cytopathic effect develops in cells overexpressing this cofactor .

Potential alternative mechanisms:

  • Alternative cellular cofactor: APPV likely utilizes a different cellular protein to regulate NS2 autoprotease activity .

  • Modified NS2 autoprotease: The APPV NS2 protease may have evolved structural differences that allow activity without DNAJC14 assistance.

  • Distinctive replication regulation: APPV may employ fundamentally different mechanisms to regulate RNA replication levels.

Research implications:

  • Synthetic viral genome development: The DNAJC14-independent replication of APPV opens possibilities for developing optimized synthetic APPV genomes as potential live vaccine candidates .

  • Evolutionary significance: The independence from DNAJC14 may represent an evolutionary adaptation that provides advantages in certain host environments or cell types.

  • Experimental models: APPV and its related constructs provide valuable tools for comparative studies of pestivirus replication mechanisms.

The distinctive behavior of APPV demonstrates the diversity of strategies employed by related viruses to accomplish similar replication steps and highlights the importance of studying exceptions to understand fundamental virus-host interactions.

What are the key challenges in DNAJC14 research for antiviral applications?

Despite significant progress in understanding DNAJC14's role in viral infections, several challenges remain for developing antiviral applications:

  • Balancing physiological functions: Targeting DNAJC14 therapeutically must account for its normal cellular functions to avoid disrupting essential cellular processes.

  • Structural complexity: The large size and multiple domains of DNAJC14 complicate the development of small molecule modulators with specific effects on viral interactions.

  • Viral adaptation mechanisms: Viruses may rapidly evolve to overcome DNAJC14-targeted interventions, as exemplified by the natural emergence of cp biotypes that replicate independently of DNAJC14 .

  • Delivery challenges: Therapeutic delivery of DNAJC14-modulating compounds to relevant tissues and cells where viral replication occurs presents significant technical hurdles.

  • Inter-species variations: Differences between human DNAJC14 and animal homologs complicate the translation of findings from animal models to human applications.

Addressing these challenges will require continued basic research into DNAJC14 structure-function relationships and innovative approaches to drug design and delivery.

What emerging techniques are advancing DNAJC14 research?

Several cutting-edge technologies are accelerating research on DNAJC14 and its viral interactions:

  • Advanced gene editing: Precision genome editing using improved CRISPR systems allows for the creation of subtle mutations or tagged endogenous DNAJC14, enabling more physiologically relevant studies .

  • Single-cell analysis: Single-cell transcriptomics and proteomics reveal cell-to-cell variability in DNAJC14 expression and its impact on viral susceptibility.

  • Cryo-electron microscopy: Advanced structural biology techniques are enabling visualization of DNAJC14-viral protein complexes at near-atomic resolution.

  • Organoid models: Three-dimensional tissue cultures provide more physiologically relevant systems for studying DNAJC14 function in complex cellular environments.

  • Artificial intelligence approaches: Machine learning algorithms are accelerating the identification of small molecules that could modulate DNAJC14-viral protein interactions.

These technological advances promise to deepen our understanding of DNAJC14's multifaceted roles in viral infections and cellular physiology, potentially leading to novel antiviral strategies.

How might understanding DNAJC14 impact broader virology and cell biology fields?

The study of DNAJC14 extends beyond its immediate role in pestivirus replication, with potential implications for multiple scientific domains:

  • Comparative virology: The divergent dependency on DNAJC14 among related viruses provides a model for understanding virus-host co-evolution and adaptation strategies.

  • Host-directed antiviral approaches: DNAJC14 research exemplifies how targeting host factors rather than viral proteins directly can provide broad-spectrum antiviral strategies with potentially higher barriers to resistance.

  • Cellular protein quality control mechanisms: Insights from DNAJC14's chaperone functions inform broader understanding of cellular proteostasis and stress response networks.

  • Membrane protein trafficking: DNAJC14's role as a dopamine receptor-interacting protein highlights its potential importance in membrane protein trafficking pathways .

  • Disease pathogenesis models: The role of DNAJC14 in pestivirus biotype switching provides a model for understanding how subtle changes in virus-host interactions can dramatically alter disease outcomes .

As research progresses, DNAJC14 may serve as a paradigm for understanding how viruses exploit and are constrained by the cellular machinery, with implications for developing novel therapeutic approaches targeting host-pathogen interfaces.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.