Recombinant Human DnaJ homolog subfamily C member 22 (DNAJC22)

Shipped with Ice Packs
In Stock

Description

Introduction to DNAJC22

DNAJC22 belongs to the DnaJ (Hsp40) family of co-chaperones, which regulate Hsp70 ATPase activity during protein folding, degradation, and translocation . The recombinant form enables researchers to bypass endogenous expression limitations, facilitating mechanistic studies of its roles in stress response and disease pathways .

Expression Systems

  • Host Organisms: E. coli, HEK293, wheat germ, and mammalian cell-free systems .

  • Yield: High-purity (>90%) preparations achieved via affinity chromatography (e.g., Ni-NTA for His-tagged variants) .

ParameterSpecificationSource
Purity≥85% (SDS-PAGE verified)
StorageLyophilized at -80°C in Tris/PBS buffer with trehalose
ReconstitutionSterile deionized water; glycerol addition recommended for stability

Biochemical Roles

  • Co-Chaperone Activity: Facilitates Hsp70-mediated protein folding by stabilizing client proteins .

  • Regulatory Pathways: Transcriptional regulation by HNF4A identified via cross-species analysis (mouse, human, zebrafish) . Knockdown of HNF4A reduces DNAJC22 expression, linking it to metabolic and hepatic functions .

Interaction Network

Key partners identified via STRING-DB and experimental studies:

Interacting ProteinFunctional AssociationMethodSource
DNAJC27GTPase activation of MEK/ERK pathwayYeast two-hybrid
HSPA4LChaperone complex assemblyCo-IP
HNF4ATranscriptional regulation in liver/kidney tissuesChIP-seq

Disease Models

  • Cancer: Overexpression of DNAJC27 (a partner) activates oncogenic ERK signaling, suggesting DNAJC22’s indirect role in cell transformation .

  • Metabolic Disorders: Reduced DNAJC22 levels correlate with HNF4A-deficient renal carcinoma and diabetic adipose tissue inflammation .

Future Directions

Current gaps include structural resolution of DNAJC22-Hsp70 complexes and in vivo validation of its role in stress adaptation. Commercial accessibility of tagged variants (e.g., Avi-tagged for interactome studies) could accelerate these efforts .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
DNAJC22; DnaJ homolog subfamily C member 22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
DNAJC22
Target Protein Sequence
MAKGLLVTYALWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQAN RAQGQRQSPRGVTPPLSPIRFAAQVIVGIYFGLVALISLSSMVNFYIVALPLAVGLGVLL VAAVGNQTSDFKNTLGSAFLTSPIFYGRPIAILPISVAASITAQRHRRYKALVASEPLSV RLYRLGLAYLAFTGPLAYSALCNTAATLSYVAETFGSFLNWFSFFPLLGRLMEFVLLLPY RIWRLLMGETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQEL VKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKPWGSRR
Uniprot No.

Target Background

Function
DNAJC22 may function as a co-chaperone.
Database Links

HGNC: 25802

KEGG: hsa:79962

STRING: 9606.ENSP00000378508

UniGene: Hs.659300

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is DNAJC22 and what is its functional role in cellular biology?

DNAJC22 (DnaJ heat shock protein family (Hsp40) member C22) primarily functions as a co-chaperone protein . As a member of the highly conserved DnaJ/Hsp40 family, it likely plays a role in protein folding and protein quality control pathways. The protein contains characteristic DnaJ domains that allow interaction with Hsp70 chaperones to facilitate protein folding processes .

Current research indicates membrane activity, suggesting potential involvement in membrane protein quality control or trafficking mechanisms . While the precise molecular mechanisms remain under investigation, its structural characteristics strongly support its classification as a co-chaperone within cellular protein homeostasis networks.

What are the structural features and domains of DNAJC22?

Human DNAJC22 has a predicted molecular weight of approximately 38 kDa . Structurally, the protein contains several key domains:

  • Chaperone J-domain superfamily region - critical for co-chaperone functionality

  • DnaJ domain - the signature domain that defines the DnaJ/Hsp40 family

  • TM2 domain - transmembrane region consistent with its predicted membrane activity

The protein's C-terminal region (amino acids 200 to C-terminus) contains important epitopes for antibody recognition, as evidenced by immunogen design for commercial antibodies . The full human protein sequence provides the foundation for recombinant protein expression systems.

How is DNAJC22 conserved across species?

DNAJC22 shows significant evolutionary conservation, with orthologs identified in various model organisms. In zebrafish (Danio rerio), the orthologous gene dnajc22 encodes a 338-amino acid protein (UniProtKB:E7F2F5) that shares domain architecture with human DNAJC22 . This conservation extends to the characteristic DnaJ domain and membrane-associated regions.

The zebrafish gene is located on chromosome 23, while the human DNAJC22 gene is positioned on chromosome 12 . Despite chromosomal location differences, the functional domains remain conserved, suggesting evolutionary pressure to maintain structural features important for biological activity.

What expression systems and methods are effective for producing recombinant DNAJC22?

For successful production of recombinant human DNAJC22, researchers typically employ several expression systems:

  • Bacterial expression systems: E. coli-based systems can be used for producing the soluble domains of DNAJC22, though the transmembrane regions may present solubility challenges.

  • Mammalian expression systems: Human cell lines such as HEK293 or CHO cells provide proper folding and post-translational modifications for full-length DNAJC22.

  • Fragment-based approach: Expression of specific regions (e.g., amino acids 200 to C-terminus) has proven successful for generating immunogens for antibody production .

When using bacterial systems, fusion tags (His, GST, MBP) can enhance solubility and facilitate purification. For full-length protein with membrane domains, detergent solubilization or nanodisc reconstitution may be necessary to maintain native structure.

What cell types and tissues are appropriate for studying endogenous DNAJC22?

Based on antibody validation studies, several cell types have been confirmed to express detectable levels of DNAJC22:

  • U-2 OS cells: Human osteosarcoma cells show positive immunofluorescent staining for DNAJC22 when fixed with PFA and permeabilized with Triton X-100 .

  • RT4 cells: Human urinary bladder transitional cell carcinoma cells exhibit detectable DNAJC22 by Western blot analysis .

These cell lines provide reliable experimental systems for studying endogenous DNAJC22 expression, localization, and function. When selecting cellular models, researchers should consider that membrane proteins often show cell-type specific expression patterns.

What are the optimal methods for detecting DNAJC22 in various experimental contexts?

Multiple validated approaches exist for DNAJC22 detection in research settings:

  • Western Blot (WB): Anti-DNAJC22 polyclonal antibodies (such as ab220239) have been validated for WB at 1/100 dilution using RT4 cell lysates, with expected band size of 38 kDa . Optimal sample preparation includes standard SDS-PAGE with transfer to PVDF or nitrocellulose membranes.

  • Immunocytochemistry/Immunofluorescence (ICC/IF): Validated protocols involve PFA fixation followed by Triton X-100 permeabilization, using anti-DNAJC22 antibodies at 4μg/ml concentration for detection in U-2 OS cells .

  • qRT-PCR: For transcript analysis, researchers should design primers spanning exon-exon junctions to avoid genomic DNA amplification. The zebrafish dnajc22 gene has multiple transcript variants (dnajc22-201: 1,480 nt; dnajc22-202: 1,014 nt; dnajc22-203: 972 nt) , suggesting human DNAJC22 may also express multiple splice variants requiring careful primer design.

When combining detection methods, correlating protein levels with transcript abundance provides more comprehensive insights into DNAJC22 regulation.

How can DNAJC22 knockout or knockdown models be effectively generated?

Several approaches can be employed to develop DNAJC22 loss-of-function models:

  • CRISPR-Cas9 genome editing:

    • Design sgRNAs targeting exonic regions to disrupt protein coding

    • Target conserved DnaJ domains for functional disruption

    • Validate knockout by sequencing, Western blot, and functional assays

  • RNA interference (RNAi):

    • siRNA or shRNA approaches targeting conserved regions

    • Multiple siRNAs should be tested to identify optimal knockdown efficiency

    • Validate knockdown at both mRNA and protein levels

  • Model organism approaches:

    • Zebrafish models offer advantages due to confirmed orthology of dnajc22

    • Morpholino-based knockdown or CRISPR knockout in zebrafish

    • Assess developmental and cellular phenotypes

When generating knockout models, researchers should consider potential compensatory mechanisms by other DnaJ family members that may mask phenotypes.

What are the methodological considerations for studying DNAJC22 interactions with other proteins?

As a predicted co-chaperone, DNAJC22 likely engages in multiple protein-protein interactions that are critical to its function . Appropriate methods include:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-DNAJC22 antibodies (such as ab220239) for immunoprecipitation

    • Mild detergents (0.5-1% NP-40 or CHAPS) maintain membrane protein interactions

    • Crosslinking prior to lysis may capture transient interactions

  • Proximity labeling approaches:

    • BioID or APEX2 fusion proteins to identify neighboring proteins

    • Particularly valuable for membrane-associated proteins like DNAJC22

    • MS analysis of biotinylated proteins reveals interaction networks

  • Yeast two-hybrid membrane system variants:

    • Split-ubiquitin systems adapted for membrane proteins

    • MYTH (Membrane Yeast Two-Hybrid) system for transmembrane protein interactions

    • Controls for proper membrane insertion are essential

When analyzing interaction data, bioinformatic filtering for known chaperone networks and membrane-associated proteins can enhance specificity and relevance of findings.

How do membrane properties of DNAJC22 affect experimental design?

The predicted membrane activity of DNAJC22 presents specific experimental challenges :

  • Protein Purification Strategies:

    • Detergent selection critical (mild non-ionic detergents like DDM or LMNG)

    • Nanodiscs or liposome reconstitution for functional studies

    • Fusion proteins with solubility enhancers may stabilize the protein

  • Localization Studies:

    • Co-localization with membrane markers using confocal microscopy

    • Membrane fractionation techniques to isolate specific compartments

    • Live-cell imaging with fluorescent tags placed to minimize membrane insertion disruption

  • Functional Assays:

    • In vitro membrane binding assays with purified components

    • Liposome co-sedimentation to assess membrane association

    • Surface plasmon resonance to measure interaction kinetics with membrane mimetics

Researchers should always validate membrane topology predictions experimentally, as computational predictions may not capture the precise membrane orientation of DNAJC22.

How can comparative analysis between DNAJC22 and other DnaJ family proteins inform functional studies?

The DnaJ/Hsp40 family includes numerous members with specialized functions. Methodological approaches for comparative analysis include:

  • Phylogenetic Analysis:

    • Multiple sequence alignment of DnaJ domains across family members

    • Identification of DNAJC22-specific sequence motifs outside conserved domains

    • Evolutionary rate analysis to identify functionally constrained regions

  • Domain Swap Experiments:

    • Replace the J-domain of DNAJC22 with that of other family members

    • Test chimeric proteins for functional complementation

    • Identify domains conferring functional specificity

  • Comparative Expression Analysis:

    • Transcriptomic analysis of expression patterns across tissues

    • Co-expression network analysis to identify functional clusters

    • Single-cell RNA sequencing to define cell-type specific expression patterns

DnaJ Family MemberKey DomainsSubcellular LocalizationKey Functional Features
DNAJC22J-domain, TM2 domainMembrane-associatedPredicted co-chaperone function
DNAJC12J-domainCytosolicPotential biomarker in breast cancer
Other DNAJCsJ-domain, variableVarious cellular compartmentsDiverse functions in protein quality control

This comparative approach contextualizes DNAJC22 within the broader family, providing insights into shared mechanisms and unique functions.

What are the major knowledge gaps in understanding DNAJC22 function?

Despite advances in characterizing DNAJC22, several important knowledge gaps persist:

  • Molecular Substrates:

    • Identity of specific protein substrates remains largely unknown

    • Systematic approaches needed to identify client proteins

    • Challenges in distinguishing direct from indirect interactions

  • Regulatory Mechanisms:

    • Transcriptional and post-translational regulation poorly characterized

    • Potential role of membrane lipid composition in modulating activity

    • Relationship to cellular stress response pathways requires clarification

  • Physiological Roles:

    • Limited understanding of tissue-specific functions

    • Potential involvement in development or disease processes

    • Connection to broader cellular proteostasis networks

Addressing these gaps requires integration of structural biology, systems biology, and model organism approaches.

How can advanced imaging techniques enhance DNAJC22 research?

Modern imaging approaches offer powerful tools for investigating membrane-associated proteins like DNAJC22:

  • Super-resolution Microscopy:

    • STORM or PALM imaging for nanoscale localization

    • Direct visualization of DNAJC22 clustering within membranes

    • Multi-color imaging to assess co-localization with potential partners

  • Live-cell Dynamics:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure mobility

    • Single-particle tracking to determine diffusion dynamics

    • Optogenetic approaches to trigger relocalization or activation

  • Correlative Light and Electron Microscopy (CLEM):

    • Precise localization within membranous compartments

    • Ultrastructural context for functional studies

    • Immunogold labeling to confirm specific localization

These methodologies provide dynamic, spatially resolved information that complements biochemical and genetic approaches.

What integrated research strategies will best advance DNAJC22 understanding?

Based on current knowledge, the most productive research approaches will combine:

  • Structural characterization of DNAJC22, focusing on membrane topology and interaction interfaces

  • Proteomic identification of interaction partners under various cellular conditions

  • Functional genomics using CRISPR screening to place DNAJC22 in cellular pathways

  • Comparative biology leveraging zebrafish and other model organisms with confirmed orthologs

  • Systems biology approaches to integrate multiple data types into coherent models

Researchers should prioritize methodological rigor, particularly in confirming antibody specificity and validating model systems for studying membrane-associated proteins.

What experimental controls are essential for rigorous DNAJC22 research?

Robust DNAJC22 research requires careful attention to several critical controls:

  • Antibody validation:

    • Knockout/knockdown controls to confirm specificity

    • Multiple antibodies targeting different epitopes when possible

    • Secondary antibody-only controls for immunofluorescence

  • Expression constructs:

    • Validation of proper membrane insertion for tagged constructs

    • Use of multiple tag positions (N-terminal vs. C-terminal)

    • Functional complementation to verify activity of recombinant protein

  • Functional assays:

    • Positive controls using known DnaJ family members

    • Negative controls with J-domain mutants

    • Dose-response relationships to establish specificity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.