Recombinant Human DnaJ homolog subfamily C member 25 (DNAJC25)

Shipped with Ice Packs
In Stock

Description

Overview of DNAJC25

DnaJ homolog subfamily C member 25 (DNAJC25), also known as DnaJ heat shock protein family member C25, is a protein belonging to the heat shock protein 40 (HSP40) family . HSP40 proteins, also named DnaJ proteins, are known for their role as co-chaperones, typically interacting with Hsp70 proteins to assist in protein folding, trafficking, and degradation processes . DNAJC25 is a protein consisting of 360 amino acids . It is encoded by the DNAJC25 gene.

Protein Interactions and Functions

DNAJC25's function includes GTPase activity, which can activate the MEK/ERK pathway and induce cell transformation when overexpressed . It may also act as a nuclear scaffold for MAPK1, enhancing ERK1/ERK2 signaling .

Predicted functional partners of DNAJC25 include :

  • HSPA4 (Heat shock protein family A member 4)

  • BRCC3 (Lys-63-specific deubiquitinase BRCC36)

  • DNAJC9 (DnaJ homolog subfamily C member 9)

  • BABAM2 (BRISC and BRCA1-A complex member 2)

  • BABAM1 (BRISC and BRCA1-A complex member 1)

  • DNAJC27 (DnaJ homolog subfamily C member 27)

  • DNAJC8 (DnaJ homolog subfamily C member 8)

  • HSPA12B (Heat shock protein family A member 12B)

  • HSPA1L (Heat shock 70 kDa protein 1-like)

  • DNAJC12 (DnaJ heat shock protein family member C12)

Tissue Expression

DNAJC25 exhibits varying expression levels across different tissues in the human body .

Role in Cancer

DNAJC25 gene has been suggested as a tumor suppressor gene in hepatocellular carcinoma . Studies suggest that DNAJC25 may have a role as a tumor suppressor in breast cancer . Reduced mRNA expression of DNAJC25 in clinical breast cancer samples compared to normal samples has been observed . High DNAJC25 expression correlates with favorable post-progression survival in breast cancer patients . Point mutations or copy number variations of DNAJC25 are uncommon in clinical breast cancer samples, and the DNAJC25 promoter is not methylated in breast cell lines .

DNAJC25 mRNA Expression and Survival Outcomes in Breast Cancer Subtypes

SubtypeSurvival OutcomeDNAJC25 mRNA Expression
Luminal ADistant Metastasis-Free SurvivalFavorable
Luminal APost-Progression SurvivalFavorable
HER2+Distant Metastasis-Free SurvivalFavorable
Luminal BRelapse-Free SurvivalUnfavorable
Luminal BDistant Metastasis-Free SurvivalUnfavorable
BasalDistant Metastasis-Free SurvivalUnfavorable

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DNAJC25; DnaJ homolog subfamily C member 25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
DNAJC25
Target Protein Sequence
MGAPLLSPGWGAGAAGRRWWMLLAPLLPALLLVRPAGALVEGLYCGTRDCYEVLGVSRSA GKAEIARAYRQLARRYHPDRYRPQPGDEGPGRTPQSAEEAFLLVATAYETLKDEETRKDY DYMLDHPEEYYSHYYHYYSRRLAPKVDVRVVILVSVCAISVFQFFSWWNSYNKAISYLAT VPKYRIQATEIAKQQGLLKKAKEKGKNKKSKEEIRDEEENIIKNIIKSKIDIKGGYQKPQ ICDLLLFQIILAPFHLCSYIVWYCRWIYNFNIKGKEYGEEERLYIIRKSMKMSKSQFDSL EDHQKETFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD
Uniprot No.

Target Background

Database Links

HGNC: 34187

KEGG: hsa:548645

STRING: 9606.ENSP00000320650

UniGene: Hs.534196

Protein Families
DNAJC25 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is DNAJC25 and what is its role in normal cellular function?

    DNAJC25 (DnaJ homolog subfamily C member 25) is a member of the HSP40/DnaJ heat shock protein family. It functions as a co-chaperone by binding to the chaperone Hsp70 through its J domain and stimulating ATP hydrolysis. This activity aids in crucial cellular processes including protein translation, folding, unfolding, translocation, and degradation . The protein consists of 360 amino acids with a calculated molecular mass of 42.4 kDa and is primarily localized in the cytoplasm of eukaryotic cells . Expression analysis across multiple tissues has revealed that DNAJC25 exhibits particularly high expression in the liver, with trace levels detected in the thymus, prostate, testis, ovary, small intestine, and colon .

  • How is DNAJC25 gene expression regulated in normal tissues?

    DNAJC25 demonstrates a tissue-specific expression pattern, with RT-PCR analysis revealing markedly high expression in liver tissue. Trace expression levels have been detected in the thymus, prostate, testis, ovary, small intestine, and colon . Notably, no amplification product was visualized in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, or spleen, suggesting minimal to no expression in these tissues . The regulation of DNAJC25 expression appears to be controlled through both genetic and epigenetic mechanisms. Analysis of the DNAJC25 promoter using Combined Bisulfite Restriction Analysis (COBRA) has shown that the promoter tends to be hypomethylated in normal tissues, allowing for baseline expression . This differential tissue expression pattern suggests a highly regulated expression system that may be tied to tissue-specific functions.

Advanced Research Questions

  • What methodologies are most effective for studying DNAJC25's role in hepatocellular carcinoma?

    To effectively study DNAJC25's role in hepatocellular carcinoma (HCC), researchers should employ a multi-faceted approach combining both in vitro and in vivo methodologies:

    1. Expression analysis: Quantitative real-time PCR should be used to compare DNAJC25 mRNA levels between HCC specimens and adjacent non-tumorous tissues. This technique has successfully identified that DNAJC25 is downregulated in 57.5% of HCC specimens (>2-fold decrease) compared to adjacent normal liver tissues .

    2. Functional analysis: Colony formation assays with HCC cell lines (such as Hep3B and SMMC-7721) overexpressing DNAJC25 can demonstrate its tumor-suppressive properties. Previous studies have shown that DNAJC25 overexpression reduces colony formation by 74.67% in Hep3B cells and 79.00% in SMMC-7721 cells .

    3. Apoptosis assessment: Flow cytometry analysis following transfection with DNAJC25 can reveal its pro-apoptotic effects. Research has shown that DNAJC25 overexpression increases the sub-G1 population (indicating apoptosis) from 13.23% to 18.80% in Hep3B cells and from 3.92% to 16.41% in HEK 293 cells .

    4. Subcellular localization: Fluorescence microscopy using DNAJC25 fused to a reporter protein (such as GFP) can determine its subcellular localization, which has been confirmed to be cytoplasmic .

    5. Molecular interaction studies: Co-immunoprecipitation assays can identify DNAJC25's binding partners, particularly its interactions with Hsp70 and potential downstream effectors in the apoptotic pathway.

  • What molecular mechanisms underlie DNAJC25's tumor suppressive function?

    DNAJC25's tumor suppressive function appears to be mediated through several molecular mechanisms:

    1. Pro-apoptotic activity: Flow cytometry analysis has demonstrated that DNAJC25 overexpression significantly increases the sub-G1 peak (indicating apoptotic cell populations) in both Hep3B and HEK 293 cells . This suggests that DNAJC25 promotes programmed cell death, which is a key mechanism for eliminating potentially cancerous cells.

    2. Inhibition of cell proliferation: Colony formation assays have shown that DNAJC25 overexpression markedly reduces both the number and size of colonies in HCC cell lines, indicating an inhibitory effect on cell growth and survival .

    3. Protein homeostasis regulation: As a member of the HSP40/DnaJ family, DNAJC25 functions as a co-chaperone by binding to Hsp70 and stimulating ATP hydrolysis. This function is critical for proper protein folding, unfolding, translocation, and degradation . Dysregulation of protein homeostasis is a hallmark of cancer, suggesting that DNAJC25 may suppress tumor growth by maintaining proper protein quality control.

    4. Interaction with apoptotic pathways: While the exact molecular interactions remain to be fully elucidated, DNAJC25's pro-apoptotic effect suggests it may interact with key components of apoptotic pathways. This contrasts with other heat shock proteins such as HSP27 and HSP70, which have been reported to be upregulated in tumors and possess anti-apoptotic properties .

  • What are the challenges in producing and working with recombinant DNAJC25 protein for research purposes?

    Working with recombinant DNAJC25 protein presents several methodological challenges that researchers must address:

    1. Expression system selection: While E. coli is commonly used for recombinant protein production , researchers must consider whether bacterial expression systems can produce properly folded DNAJC25 with functional activity. Mammalian expression systems may be necessary for studying certain aspects of DNAJC25 function, particularly those involving post-translational modifications.

    2. Protein solubility and stability: As a 42.4 kDa protein, DNAJC25 may face solubility challenges during recombinant expression. Optimization of buffer conditions (pH, salt concentration, additives) is essential for maintaining protein stability. Current protocols recommend storing DNAJC25 in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

    3. Freeze-thaw stability: Recombinant DNAJC25 is sensitive to repeated freeze-thaw cycles, which can lead to protein denaturation and loss of activity. Working aliquots should be stored at 4°C for up to one week, with long-term storage requiring aliquoting with 5-50% glycerol at -20°C/-80°C .

    4. Functional validation: Ensuring that recombinant DNAJC25 retains its co-chaperone activity requires functional assays to verify its ability to stimulate Hsp70's ATPase activity and participate in protein folding processes.

    5. Tag interference: The presence of fusion tags (such as His-tags) may interfere with DNAJC25's native structure or function . Researchers must verify that tagged versions of the protein retain biological activity or consider tag removal strategies.

  • How might epigenetic modifications affect DNAJC25 expression in different cancer types?

    Epigenetic modifications play a crucial role in regulating DNAJC25 expression across different cancer types:

    1. DNA methylation patterns: Combined Bisulfite Restriction Analysis (COBRA) has shown that the DNAJC25 promoter tends to be hypomethylated in both normal and tumor breast tissues (Beta-value<0.25) . This contrasts with the typical pattern of tumor suppressor genes, which often show promoter hypermethylation in cancer. The persistence of hypomethylation suggests that alternative mechanisms may be responsible for DNAJC25 downregulation in cancer.

    2. Tissue-specific epigenetic regulation: The epigenetic regulation of DNAJC25 appears to vary between tissue types. While promoter methylation may not be the primary regulatory mechanism in breast cancer, other epigenetic modifications such as histone modifications or chromatin remodeling could play more significant roles in different cancer types.

    3. Interaction with transcription factors: Epigenetic modifications can affect the accessibility of transcription factor binding sites in the DNAJC25 promoter region. Analysis of transcription factor binding patterns in conjunction with epigenetic marks would provide insights into the regulatory mechanisms controlling DNAJC25 expression.

    4. microRNA regulation: Post-transcriptional regulation by microRNAs represents another potential epigenetic mechanism affecting DNAJC25 expression. Identification of microRNAs targeting DNAJC25 mRNA could explain discrepancies between promoter methylation status and expression levels.

  • What genetic alterations of DNAJC25 are associated with cancer progression?

    Genetic alterations of DNAJC25 in cancer appear to be relatively rare but potentially significant:

    1. Point mutations: Analysis of clinical breast cancer samples indicates that DNAJC25 point mutations are infrequent . This suggests that when DNAJC25 is involved in cancer progression, it is more likely through altered expression levels rather than functional mutations.

    2. Copy number variations: Copy number alterations of DNAJC25 are also rare in clinical breast cancer specimens . The limited frequency of these genetic changes further supports the hypothesis that epigenetic or post-transcriptional mechanisms may be more relevant to DNAJC25 regulation in cancer.

    3. Expression alterations: While genetic mutations are uncommon, significant expression changes are observed in multiple cancer types. In hepatocellular carcinoma, DNAJC25 is downregulated in 57.5% of cases (>2-fold decrease), normally expressed in 29.9%, and overexpressed in 12.6% (>2-fold increase) . In breast cancer, clinical samples show significantly lower DNAJC25 mRNA levels compared to normal samples .

    4. Prognostic implications: Despite the rarity of genetic alterations, DNAJC25 expression levels have prognostic significance. In breast cancer, higher DNAJC25 expression is associated with better post-progression survival (P=0.0035) , suggesting that expression levels, rather than mutations, may be more relevant for clinical outcomes.

  • How does DNAJC25 interact with other heat shock proteins in tumor microenvironments?

    DNAJC25's interactions with other heat shock proteins in tumor microenvironments reveal complex regulatory networks:

    1. Hsp70 interaction dynamics: As a DNAJ family member, DNAJC25 functions as a co-chaperone by binding to Hsp70 through its J domain and stimulating ATP hydrolysis . In tumor microenvironments, this interaction may be altered due to changes in expression levels of both proteins or modifications affecting their binding affinity.

    2. Opposing functions to other HSPs: Interestingly, DNAJC25's tumor suppressive function contrasts with the roles of certain other heat shock proteins such as HSP27 and HSP70, which have been reported to be upregulated in tumors and possess anti-apoptotic properties . This suggests that the HSP family contains members with opposing functions in cancer progression.

    3. Competition with other co-chaperones: Multiple DNAJ proteins compete for binding to Hsp70 chaperones. Alterations in the expression ratios of different DNAJ proteins in cancer cells could affect DNAJC25's ability to interact with Hsp70 and influence its tumor suppressive function.

    4. Downstream effects on client proteins: Through its co-chaperone function, DNAJC25 influences the folding, stability, and activity of various client proteins. In tumor microenvironments, these clients may include oncoproteins or tumor suppressors, thereby affecting cancer cell survival, proliferation, and response to therapy.

    5. Extracellular roles: While primarily characterized as an intracellular protein, some heat shock proteins can be released into the extracellular space where they influence immune responses and cell-cell communication in the tumor microenvironment. Whether DNAJC25 exhibits similar extracellular functions remains to be investigated.

Experimental Design and Methodology

  • What are the optimal conditions for expressing and purifying recombinant DNAJC25?

    Successful expression and purification of recombinant DNAJC25 requires careful optimization of multiple parameters:

    1. Expression system selection: E. coli is commonly used for recombinant DNAJC25 production . For full-length human DNAJC25 (1-360 amino acids), bacterial expression has proven effective, though researchers should consider mammalian systems if post-translational modifications are critical to their studies.

    2. Tag selection and placement: N-terminal His-tagging has been successfully employed for DNAJC25 purification . The tag placement should minimize interference with protein folding and function.

    3. Expression conditions: Optimization of induction temperature, duration, and inducer concentration is essential. Lower temperatures (16-25°C) often improve the solubility of recombinant proteins in E. coli.

    4. Cell lysis and initial purification: Gentle lysis methods and inclusion of protease inhibitors help preserve protein integrity. For His-tagged DNAJC25, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is the primary purification step.

    5. Buffer optimization: The optimal buffer for DNAJC25 stability appears to be Tris/PBS-based with 6% trehalose at pH 8.0 . This formulation helps maintain protein solubility and activity.

    6. Storage conditions: To prevent activity loss, DNAJC25 should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for long-term storage at -20°C/-80°C . Working aliquots can be stored at 4°C for up to one week, and repeated freeze-thaw cycles should be avoided.

  • How can researchers effectively measure DNAJC25's co-chaperone activity in experimental settings?

    Measuring DNAJC25's co-chaperone activity requires specialized assays that evaluate its ability to stimulate Hsp70's ATPase activity and influence protein folding:

    1. ATPase stimulation assay: This is the most direct measure of co-chaperone function. Purified recombinant DNAJC25 is incubated with Hsp70 and ATP, and the rate of ATP hydrolysis is measured. Techniques include:

      • Colorimetric assays using malachite green to detect released phosphate

      • Coupled enzymatic assays where ATP regeneration is linked to NADH oxidation

      • Radioactive assays using [γ-32P]ATP to measure phosphate release

    2. Protein folding assays: These assess DNAJC25's ability to assist Hsp70 in protein folding:

      • Luciferase refolding assay: Measures the recovery of luciferase activity after denaturation

      • Aggregation prevention assays: Monitor the ability of DNAJC25/Hsp70 to prevent protein aggregation using light scattering

      • Client protein binding assays: Evaluate the formation of DNAJC25/Hsp70/client protein complexes using co-immunoprecipitation or surface plasmon resonance

    3. Cellular assays: These evaluate DNAJC25's function in a more physiological context:

      • Protein quality control using reporter substrates

      • Stress response activation monitoring

      • Cell viability and apoptosis assays following stress conditions

    4. Protein-protein interaction assays: These confirm DNAJC25's physical interaction with Hsp70:

      • Pull-down assays using purified proteins

      • Yeast two-hybrid screening

      • FRET or BiFC to visualize interactions in living cells

  • What are the best approaches for studying DNAJC25's role in apoptosis regulation?

    To comprehensively investigate DNAJC25's role in apoptosis regulation, researchers should employ multiple complementary approaches:

    1. Flow cytometry analysis: This technique has successfully demonstrated DNAJC25's pro-apoptotic effects by revealing increased sub-G1 peaks (indicating apoptotic cell populations) following DNAJC25 overexpression in Hep3B (18.80% vs. 13.23% in control) and HEK 293 cells (16.41% vs. 3.92% in control) .

    2. Apoptosis marker detection: Researchers should evaluate changes in key apoptosis markers following DNAJC25 manipulation:

      • Annexin V/PI staining to distinguish early and late apoptotic cells

      • TUNEL assay to detect DNA fragmentation

      • Caspase activation assays (particularly caspase-3, -8, and -9)

      • Mitochondrial membrane potential measurements

      • Cytochrome c release from mitochondria

    3. Genetic manipulation approaches:

      • Overexpression studies using transfection with DNAJC25 expression vectors

      • Knockdown experiments using siRNA or shRNA

      • CRISPR/Cas9-mediated knockout for complete gene deletion

      • Domain mutation analysis to identify functional regions critical for apoptosis induction

    4. Pathway analysis:

      • Western blotting for pro- and anti-apoptotic proteins (Bcl-2 family members, IAPs)

      • Protein-protein interaction studies to identify DNAJC25's binding partners in apoptotic pathways

      • Transcriptomic analysis to identify genes regulated by DNAJC25

    5. In vivo validation:

      • Xenograft models with DNAJC25-modulated cancer cells

      • Analysis of tumor growth, apoptotic index, and survival outcomes

  • How can researchers resolve conflicting data on DNAJC25 expression patterns in different cancer types?

    Resolving conflicting data on DNAJC25 expression across cancer types requires a systematic approach addressing multiple factors:

    1. Standardized methodology implementation:

      • Use consistent RNA extraction and quality control methods

      • Employ multiple reference genes for qRT-PCR normalization

      • Validate findings with protein-level measurements using standardized antibodies

      • Implement both absolute and relative quantification approaches

    2. Sample stratification and context consideration:

      • Stratify samples by cancer subtype, stage, grade, and molecular classification

      • Consider cellular heterogeneity within tumors (single-cell analysis may reveal cell type-specific patterns)

      • Account for patient demographics, treatment history, and comorbidities

      • Compare expression in matched tumor-normal pairs from the same patients

    3. Multi-omics integration:

      • Correlate expression data with genomic alterations (mutations, CNVs)

      • Analyze epigenetic modifications (DNA methylation, histone modifications)

      • Examine post-transcriptional regulation (miRNAs, RNA-binding proteins)

      • Investigate protein degradation rates and post-translational modifications

    4. Experimental validation:

      • Perform cell-type specific expression analysis in vitro using diverse cell lines

      • Validate findings in independent patient cohorts

      • Use multiple detection methods (qRT-PCR, RNA-seq, in situ hybridization, immunohistochemistry)

    5. Meta-analysis approaches:

      • Conduct systematic reviews and meta-analyses of published data

      • Utilize public databases (TCGA, GEO, ICGC) for large-scale validation

      • Implement statistical methods to account for batch effects and study heterogeneity

  • What guidelines should researchers follow when developing DNAJC25-based biomarkers for cancer?

    Developing DNAJC25-based biomarkers for cancer requires adherence to rigorous guidelines:

    1. Discovery phase considerations:

      • Evaluate DNAJC25's expression across large, well-annotated patient cohorts

      • Assess both mRNA and protein levels using standardized methods

      • Determine tissue-specific expression patterns and thresholds

      • Consider DNAJC25's potential as a prognostic biomarker based on its association with post-progression survival in breast cancer (P=0.0035)

    2. Analytical validation requirements:

      • Establish assay precision, accuracy, sensitivity, and specificity

      • Determine limits of detection and quantification

      • Evaluate pre-analytical variables (sample collection, processing, storage)

      • Assess assay robustness across different laboratories and platforms

    3. Clinical validation strategy:

      • Design prospective studies with adequate sample sizes and follow-up

      • Include diverse patient populations to ensure generalizability

      • Compare DNAJC25's performance against established biomarkers

      • Evaluate its independent prognostic/predictive value in multivariate models

    4. Implementation considerations:

      • Develop standardized protocols for clinical laboratories

      • Establish reference ranges and decision thresholds

      • Create quality control materials and proficiency testing

      • Consider cost-effectiveness and accessibility

    5. Combinatorial biomarker approaches:

      • Evaluate DNAJC25 in combination with other biomarkers

      • Develop multiparameter algorithms incorporating clinical and molecular data

      • Consider tissue-specific biomarker panels (e.g., different approaches for hepatocellular carcinoma vs. breast cancer)

Future Research Directions

  • What potential therapeutic strategies could target DNAJC25 or its pathways?

    Developing therapeutic strategies targeting DNAJC25 or its pathways presents several promising avenues:

    1. DNAJC25 expression restoration:

      • Gene therapy approaches to restore DNAJC25 expression in cancers where it is downregulated

      • Epigenetic modifiers (HDAC inhibitors, DNA methyltransferase inhibitors) to potentially upregulate DNAJC25 if silenced by epigenetic mechanisms

      • Small molecules that enhance DNAJC25 transcription or stabilize its mRNA

    2. DNAJC25 protein modulation:

      • Small molecules that enhance DNAJC25's co-chaperone activity or stabilize the protein

      • Peptide mimetics that recapitulate DNAJC25's pro-apoptotic function

      • Targeted protein degradation approaches (PROTACs) for contexts where DNAJC25 may be oncogenic

    3. Pathway-based strategies:

      • Targeting Hsp70-DNAJC25 interactions to modulate chaperone function in cancer cells

      • Combination therapies targeting multiple components of protein quality control pathways

      • Exploiting synthetic lethality between DNAJC25 status and other cellular pathways

    4. Context-specific approaches:

      • Developing tissue-specific delivery methods based on DNAJC25's differential expression patterns

      • Biomarker-guided treatment selection for patients with altered DNAJC25 expression

      • Combination with conventional therapies based on DNAJC25 status

    5. Immunotherapy strategies:

      • Investigating whether DNAJC25 could generate tumor-specific antigens for cancer vaccines

      • Exploring if DNAJC25's heat shock protein function could be exploited to enhance antigen presentation

  • What emerging technologies could advance our understanding of DNAJC25's function in cancer?

    Several emerging technologies offer promising approaches to deepen our understanding of DNAJC25's function in cancer:

    1. Single-cell multi-omics:

      • Single-cell RNA sequencing to resolve DNAJC25 expression heterogeneity within tumors

      • Single-cell proteomics to correlate DNAJC25 protein levels with cellular phenotypes

      • Integrated single-cell multi-omics to connect genomic, transcriptomic, and proteomic data

    2. Advanced imaging techniques:

      • Super-resolution microscopy to visualize DNAJC25's subcellular localization at nanoscale resolution

      • Live-cell imaging to track DNAJC25 dynamics during cellular processes

      • Correlative light and electron microscopy to connect DNAJC25 localization with ultrastructural features

    3. Protein interaction mapping:

      • Proximity labeling techniques (BioID, APEX) to identify DNAJC25's protein interaction network in living cells

      • Hydrogen-deuterium exchange mass spectrometry to map dynamic protein interactions

      • Cryo-electron microscopy to determine DNAJC25-Hsp70 complex structures

    4. Functional genomics:

      • CRISPR screening to identify synthetic lethal interactions with DNAJC25

      • CRISPR activation/inhibition to modulate DNAJC25 expression without genetic modification

      • Base editing or prime editing for precise modification of DNAJC25 regulatory elements

    5. Computational and systems biology approaches:

      • Machine learning to predict DNAJC25's impact on cancer progression from multi-omics data

      • Network analysis to position DNAJC25 within broader cellular signaling pathways

      • Molecular dynamics simulations to understand DNAJC25's structural dynamics and interactions

  • How might DNAJC25 function across different cancer stages and treatment responses?

    Understanding DNAJC25's role across cancer progression stages and treatment responses requires investigation of its dynamic functions:

    1. Cancer initiation and early-stage disease:

      • Evaluate DNAJC25 expression changes during malignant transformation

      • Investigate whether DNAJC25 downregulation is an early or late event in carcinogenesis

      • Determine if DNAJC25 status affects cancer stem cell properties or tumor-initiating capacity

    2. Disease progression and metastasis:

      • Analyze DNAJC25 expression in primary tumors versus metastatic sites

      • Investigate whether DNAJC25 affects epithelial-mesenchymal transition, invasion, or migration

      • Determine if DNAJC25 status correlates with circulating tumor cell characteristics

    3. Treatment response prediction:

      • Evaluate whether baseline DNAJC25 expression predicts response to standard therapies

      • Investigate dynamic changes in DNAJC25 expression during treatment

      • Determine if DNAJC25 modulates sensitivity to specific therapeutic agents

    4. Resistance mechanisms:

      • Explore whether DNAJC25 alterations contribute to treatment resistance

      • Investigate DNAJC25's role in stress response pathways activated by therapy

      • Determine if combination therapies targeting DNAJC25 can overcome resistance

    5. Longitudinal monitoring:

      • Develop minimally invasive methods to monitor DNAJC25 status during treatment

      • Investigate DNAJC25's potential as a marker of minimal residual disease

      • Evaluate whether DNAJC25 expression in circulating tumor DNA or exosomes reflects tumor status

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.