Recombinant Human Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (RPN2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Dolichyl-diphosphooligosaccharide--protein Glycosyltransferase Subunit 2 (RPN2)

RPN2, also known as ribophorin II, is a subunit of the N-oligosaccharyltransferase (OST) complex, which is responsible for catalyzing the initial step in N-linked glycosylation, a crucial post-translational modification in eukaryotes . This modification involves the transfer of a pre-assembled glycan to specific asparagine residues on nascent polypeptide chains as they enter the endoplasmic reticulum (ER) .

Structure and Function

RPN2 is a type I transmembrane protein that plays a vital role in protein glycosylation and is essential for the proper folding, stability, and function of many glycoproteins . The protein contains multiple proteasome/cyclosome (PC) repeats that form a toroidal structure consisting of two concentric rings of $$\alpha$$ helices . The N-terminal domain, which is rod-like, and the C-terminal domain, which is globular, extend from one face of the toroid . The C-terminal domain binds to the ubiquitin receptor Rpn13 .

RPN2 in the 26S Proteasome

RPN2 is a subunit of the 19S regulatory particle (19S-RP) of the 26S proteasome, which is responsible for degrading ubiquitylated proteins . As a scaffolding subunit, RPN2, along with Rpn1, functions to engage ubiquitin receptors, facilitating the recognition, unfolding, and delivery of ubiquitylated substrates to the 20S core for proteolysis .

Clinical Significance

RPN2 has been implicated in various cancers, with its expression levels often correlating with disease progression and drug resistance . Studies have shown that RPN2 can regulate the glycosylation of multi-drug resistance proteins, such as P-glycoprotein, affecting the sensitivity of cancer cells to chemotherapeutic drugs .

  • Non-Small Cell Lung Cancer (NSCLC): High RPN2 expression is correlated with early recurrence, distant metastasis, and poor survival in NSCLC patients . Silencing RPN2 can suppress cell proliferation and invasiveness and increase the sensitivity of lung cancer cells to chemotherapeutic drugs .

  • Breast Cancer: RPN2 regulates tumor initiation and metastasis through the stabilization of mutant p53 . It also modulates docetaxel sensitivity in breast cancer cells through the glycosylation of P-glycoproteins .

  • Esophageal Squamous Cell Carcinoma: RPN2 expression can predict the docetaxel response .

  • Pancreatic Cancer: RPN2 is highly expressed in CD24+CD44+ cancer stem-like cells .

RPN2 as a Therapeutic Target

Given its involvement in cancer progression and drug resistance, RPN2 represents a potential therapeutic target. Targeting RPN2 through RNA interference (RNAi) has shown promise in preclinical studies, leading to cell death and increased sensitivity to chemotherapy in cancer cells .

Rpn13-Rpn2 Complex Structure

The C-terminal of Rpn2 interacts with Rpn13 . Specifically, the C-terminal 38 amino acids of hRpn2 are sufficient for interaction with hRpn13 . A study using isothermal titration calorimetry found that hRpn2 (940–953) binds to hRpn13 Pru with a dissociation constant (Kd) of 27±10 nM . Further truncation to hRpn2 (944–953) impaired binding, with an increased Kd value of 1.96±0.22 μM .

Interactions within the Rpn13-Rpn2 Complex

The Rpn13-Rpn2 complex involves extensive interactions, including proline-rich contacts. hRpn2 (940–953) includes four prolines, all of which interact with hRpn13 amino acids from a trans configuration . Strictly conserved P942, P944, and P945 bury hRpn13 W108 .

Steric Hindrance of RA190 Binding by Rpn2

The structure of the hRpn13-hRpn2 complex suggests that hRpn2 sterically blocks the RA190 binding site at C88 . RA190-conjugated hRpn13 Pru was not detected when the experiment was conducted with hRpn2 present, suggesting that RA190 cannot compete with hRpn2 (940–953) for hRpn13 Pru interaction .

Data Tables

StudyCancer TypeFindings
Kurashige et al.Esophageal Squamous Cell CarcinomaRPN2 expression predicts docetaxel response
Takahashi et al.Breast CancerRPN2 regulates tumor initiation and metastasis through mutant p53 stabilization
Zhu et al.Pancreatic CancerRPN2 is highly expressed in CD24+CD44+ cancer stem-like cells
et al.NSCLCHigh RPN2 expression correlates with early recurrence, distant metastasis, and poor survival; RPN2 silencing suppresses malignancy
ExperimentConditionsResults
Isothermal Titration Calorimetry (ITC)hRpn2 (940–953) binding to hRpn13 PruKd = 27±10 nM
Thermal Stability (DSF)hRpn13 Pru with and without hRpn2 (940–953)Shift in melting temperature for hRpn13 Pru from 44.6±0.5 to 59.4±0.3 °C upon binding hRpn2 (940–953)
Fluorescence Polarization (FP)Full-length hRpn13 and hRpn2 (940–953)Kd = 14.7±0.6 nM
Mass Spectrometry of RA190-conjugated hRpn13With and without hRpn2 (940–953)RA190-conjugated hRpn13 Pru was not detected when hRpn2 was present, indicating that RA190 cannot compete with hRpn2 for hRpn13 Pru interaction

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RPN2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit; RIBIIR; Ribophorin II; RPN-II; Ribophorin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-631
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
LTPTHYLTKHDVERLKASLDRPFTNLESAFYSIVGLSSLGAQVPDAKKACTYIRSNLDPS NVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQ EALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFE EGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVL SHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQK TSFTPVGDVFELNFMNVKFSSGYYDFLVEVEGDNRYIANTVELRVKISTEVGITNVDLST VDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQK TGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVV IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALWIR IGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLA QQAVKRTAH
Uniprot No.

Target Background

Function

Recombinant Human Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (RPN2) is a subunit of the oligosaccharyltransferase (OST) complex. This complex catalyzes the transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the initial step in protein N-glycosylation. N-glycosylation occurs co-translationally, and the OST complex associates with the Sec61 complex at the translocon, facilitating protein translocation across the endoplasmic reticulum (ER). All OST subunits are necessary for maximal enzyme activity.

Gene References Into Functions
  1. Rpn13-Rpn2 complex structural analysis reveals that RA190 targets hRpn13 and Uch37 through parallel mechanisms at proteasomes. Uch37 inactivation by RA190 prevents the disassembly of hRpn13-bound ubiquitin chains. PMID: 28598414
  2. Findings indicate a novel tumor-promoting pathway involving RPN2 in colorectal cancer (CRC), providing significant insights into CRC tumorigenesis. PMID: 29749494
  3. RPN2 expression correlates with gastric adenocarcinoma cell invasion and demonstrates potential as a prognostic factor in human gastric adenocarcinoma. PMID: 28035352
  4. Data suggest RPN2's involvement in regulating lethal cancer phenotypes, making it a potential target for RNAi-based therapies against non-small cell lung cancer. PMID: 25595901
  5. Deregulation of several genes, including CDK1, CDK2, CDK4, MCM2, MCM3, MCM4, EIF3a, and RPN2, shows potential association with disease development and progression. PMID: 24386425
  6. High CD63 glycosylation by RPN2 is implicated in clinical outcomes for breast cancer patients. PMID: 24884960
  7. High RPN2 expression and mtp53 accumulation were associated with cancer tissues in a cohort of metastatic breast cancer patients. PMID: 23959174
  8. Rpn13 binding to the proteasome scaffolding protein hRpn2/S1 disrupts its interdomain interactions, activating hRpn13 for ubiquitin binding. PMID: 20471946
  9. The RPN2 gene confers docetaxel resistance in breast cancer. PMID: 18724378
  10. S-glutathionylation of Rpn2 contributes to H2O2-induced inhibition of 26S proteasomal function. PMID: 19549781
  11. Metabolically labeled p53 decay exhibits biphasic kinetics; the 20S proteasome handles the first phase, while the 26S proteasome is required for the second. PMID: 19617345
Database Links

HGNC: 10382

OMIM: 180490

KEGG: hsa:6185

STRING: 9606.ENSP00000237530

UniGene: Hs.370895

Protein Families
SWP1 family
Subcellular Location
Endoplasmic reticulum. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in all tissues tested.

Q&A

What is the primary biological role of RPN2 in protein glycosylation?

RPN2 serves as a critical component of the oligosaccharyltransferase (OST) complex, facilitating the transfer of preassembled oligosaccharides to asparagine residues on nascent polypeptides. Methodologically, researchers confirm this role through:

  • Co-immunoprecipitation assays to identify OST complex interactions

  • Glycosylation profiling using lectin-based western blotting to compare wild-type vs. RPN2-silenced cells

  • Structural analysis via cryo-EM to map RPN2's binding interface with dolichyl-diphosphooligosaccharides

What experimental models validate RPN2's functional significance?

Model SystemApplicationKey Readouts
NSCLC cell lines (A549, H1299)Metastasis studiesInvasion (Transwell assay), EMT markers (E-cadherin, vimentin)
CRISPR-Cas9 knockoutsGlycosylation validationLC-MS/MS N-glycoproteomics
Patient-derived xenograftsTherapeutic responseTumor volume, survival analysis

How do researchers quantify RPN2 expression dynamics?

A tiered detection framework is employed:

  • Primary screening: IHC staining (≥10% membrane positivity = high expression)

  • Validation: qRT-PCR with primers spanning exons 4–6 (ΔΔCt method)

  • Functional correlation: RNAi silencing followed by functional assays (proliferation, apoptosis)

Resolving contradictions in RPN2 expression data across studies

Conflicting reports about RPN2's prognostic value stem from:

Technical Variables

FactorSolution
Antibody specificityValidate using siRNA-mediated knockdown controls
Tumor heterogeneityLaser-capture microdissection of epithelial regions
Stromal contaminationDigital pathology algorithms (e.g., HALO®)

Biological Context

  • Subcellular localization: Nuclear vs. cytoplasmic RPN2 exhibits divergent correlations with survival

  • Post-translational modifications: Phosphoproteomics reveals regulatory sites affecting OST activity

Designing RPN2-centric therapeutic studies

A phased approach ensures rigor:

Phase I: Target Validation

  • Conditional knockouts: Tet-On shRNA systems to avoid developmental compensation

  • Multi-omics integration: Correlate RPN2 levels with phosphoproteome/glycome changes

Phase II: Therapeutic Testing

ModalityDesign Consideration
siRNA nanoparticlesBiodistribution tracking via Cy5.5 labeling
Small-molecule inhibitorsDifferential scanning fluorimetry for OST complex stabilization
Combination therapiesSequential vs. concurrent dosing with taxanes

Advanced glycosylation profiling workflows

Recent protocols combine:

  • Click chemistry: Metabolic labeling with azido-fucose analogs

  • Super-resolution microscopy: STED imaging of OST complex dynamics

  • Machine learning: Neural networks predicting glycosylation sites from RPN2 expression

Statistical frameworks for clinical correlations

A NSCLC cohort analysis (n=177) demonstrated:

RPN2 Expression5-Year SurvivalHazard Ratio (95% CI)
High (n=98)32%2.41 (1.67–3.48)
Low (n=79)61%Reference

Cox regression models should adjust for EGFR mutation status and PD-L1 expression to isolate RPN2-specific effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.