Recombinant Human Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1)

Shipped with Ice Packs
In Stock

Description

Functional Role in N-linked Glycosylation

DAD1 is a conserved subunit of the oligosaccharyltransferase (OST) complex, which catalyzes the transfer of oligosaccharides to asparagine residues in nascent proteins during co-translational modification . Key functions include:

  • OST Complex Integrity: DAD1 stabilizes interactions between OST subunits (e.g., ribophorin I, ribophorin II, OST48) .

  • Apoptosis Regulation: Loss of DAD1 disrupts OST function, leading to defective glycosylation and activation of endoplasmic reticulum (ER) stress-induced apoptosis .

Research Applications

Recombinant DAD1 is utilized in:

  • Mechanistic Studies: Investigating OST assembly and N-linked glycosylation pathways .

  • Apoptosis Models: Analyzing ER stress-mediated cell death in cancer and developmental biology .

  • Therapeutic Targets: Overexpression of DAD1 correlates with carcinogenesis, making it a potential biomarker in prostate cancer and hepatocellular carcinoma .

Key Research Findings

Study FocusFindingsCitations
OST Subunit InteractionsDAD1 crosslinks with OST48 and ribophorins, confirming its role in OST structural stability .
Apoptosis MechanismDAD1 depletion in tsBN7 cells triggers apoptosis via ER stress, independent of Bcl-2 pathways .
Cancer RelevanceElevated DAD1 expression in prostate cancer tissues correlates with disease progression and resistance to therapy .

Reconstitution and Stability

  • Reconstitution: Solubilize in Tris/PBS buffer (pH 8.0) with 50% glycerol for long-term storage .

  • Stability: Avoid repeated freeze-thaw cycles; aliquot for single-use applications .

Evolutionary and Clinical Significance

DAD1 is evolutionarily conserved across eukaryotes, underscoring its essential role in glycosylation . Clinically, its dual function in glycosylation and apoptosis regulation positions it as a target for therapies addressing ER stress-related diseases and cancer .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
DAD1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; Defender against cell death 1; DAD-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-113
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
SASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFI SCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
Uniprot No.

Target Background

Function
DAD1 is a subunit of the oligosaccharyl transferase (OST) complex. This complex catalyzes the initial transfer of a specific glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This marks the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally, and the complex associates with the Sec61 complex, located at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are essential for maximal enzyme activity. DAD1 is involved in the assembly of both SST3A- and SS3B-containing OST complexes. Loss of the DAD1 protein triggers apoptosis.
Gene References Into Functions
  1. This study indicates that abnormal expression of DAD1 may be linked to the hyperfunction of immune responses and excessive apoptosis of severe aplastic anemia CD34(+) cells. PMID: 27086042
  2. Single-nucleotide polymorphisms in the DAD1 gene are associated with neuroendocrine tumors. PMID: 21606320
  3. DAD1 gene expression is decreased in follicular variant of papillary thyroid carcinoma. PMID: 21509594
  4. DAD1 protein overexpression is associated with small bowel carcinoid tumors. PMID: 18383209
Database Links

HGNC: 2664

OMIM: 600243

KEGG: hsa:1603

STRING: 9606.ENSP00000250498

UniGene: Hs.82890

Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is DAD1 and what are its primary functions?

DAD1 (Defender Against Cell Death 1) was initially identified as a negative regulator of programmed cell death, playing a crucial role in normal organism development and tissue homeostasis. Subsequent research revealed that DAD1 functions as a subunit of the mammalian oligosaccharyltransferase complex, where it is essential for both functional performance and structural integrity of the complex .

Unlike what its name might suggest, DAD1 is not related to the inhibitor of apoptosis proteins (IAP) family and does not contain any baculoviral IAP repeat (BIR) domains, which are characteristic of many anti-apoptotic proteins . The protein's dual role in apoptosis regulation and protein glycosylation makes it a fascinating subject for researchers interested in cellular survival mechanisms and protein processing pathways.

What detection methods are most effective for identifying and quantifying DAD1?

For detecting endogenous DAD1, immunological methods using specific antibodies represent the most reliable approach. Polyclonal antibodies that recognize total Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 are commercially available and can be used in various experimental contexts .

When working with DAD1, researchers should consider the following detection methods:

MethodApplicationSensitivityNotes
Western BlotProtein expressionHighCan detect endogenous levels; use blocking with recombinant fragment controls
ImmunocytochemistryCellular localizationModerate-HighUseful for subcellular localization studies
ImmunohistochemistryTissue expressionModerate-HighEffective for tissue sections with proper controls
RT-PCR/qPCRmRNA expressionVery HighDoes not confirm protein expression

When using antibody-based techniques, verification through blocking experiments using recombinant protein control fragments is strongly recommended to confirm specificity of detection .

What experimental models are suitable for studying DAD1 function?

Based on published research, several model systems have proven valuable for DAD1 functional studies:

  • Cell culture models: The BHK21 cell line, where DAD1 was initially discovered, remains relevant for basic functional studies .

  • Murine models: Knockout mice studies have demonstrated that absence of DAD1 leads to abnormal N-linked glycoproteins and increased apoptotic-associated embryonic death, making mouse models particularly useful for developmental studies .

  • Cancer cell models: Given the observed overexpression of DAD1 mRNA in certain human hepatocellular carcinomas, these cellular systems can be valuable for investigating DAD1's potential role in carcinogenesis .

When selecting an experimental model, researchers should consider the specific aspect of DAD1 function they wish to investigate—whether focusing on its role in glycosylation, apoptosis regulation, or potential contributions to cancer development.

What experimental designs are most effective for investigating DAD1's dual roles in apoptosis and glycosylation?

When studying the multifunctional nature of DAD1, researchers should employ experimental designs that can distinguish between its roles in apoptosis and glycosylation. A robust experimental design should include:

  • Variable manipulation: Systematically vary DAD1 expression levels through knockdown, knockout, or overexpression systems to observe effects on both pathways .

  • Control groups: Include appropriate controls (e.g., wild-type cells, vector-only transfections) to isolate DAD1-specific effects .

  • Specific endpoint measurements:

    • For apoptosis: Caspase activation assays, TUNEL staining, Annexin V binding

    • For glycosylation: Lectin binding assays, glycoprotein structural analysis, oligosaccharyltransferase activity assays

  • Time-course studies: Analyze temporal relationships between glycosylation defects and apoptotic activation.

True experimental design in this context requires random assignment of experimental units and careful control of extraneous variables that might influence either apoptotic pathways or glycosylation processes . Particularly important is controlling for cellular stress responses that might indirectly affect both pathways.

How can researchers effectively use DAD1 control fragments in blocking experiments?

Recombinant DAD1 protein fragments, such as the human DAD1 (aa 1-28) control fragment, provide valuable tools for validation in immunological experiments. For optimal implementation:

  • Blocking ratio determination: Use a 100x molar excess of the protein fragment control based on the antibody concentration and molecular weight for effective competition .

  • Pre-incubation protocol: Pre-incubate the antibody-protein control fragment mixture for 30 minutes at room temperature before application to the experimental sample .

  • Application across methods: This blocking approach can be effectively applied in immunohistochemistry, immunocytochemistry, and Western blot experiments to confirm antibody specificity .

  • Control design: Always include:

    • Primary antibody only (no blocking)

    • Primary antibody + specific blocking peptide

    • Primary antibody + non-specific peptide (negative control)

This methodological approach helps distinguish between specific and non-specific antibody binding, crucial for accurate interpretation of DAD1 detection results in complex biological samples.

What methodological considerations are important when investigating DAD1's role in carcinogenesis?

The observed overexpression of DAD1 mRNA in some human hepatocellular carcinomas suggests a potential role in carcinogenesis . When investigating this aspect of DAD1 function, researchers should consider:

  • Sample selection and stratification:

    • Compare DAD1 expression across:

      • Tumor vs. adjacent non-tumor tissue

      • Different tumor stages/grades

      • Various cancer subtypes

  • Expression correlation studies: Analyze relationships between DAD1 expression and:

    • Patient survival outcomes

    • Tumor invasiveness markers

    • Glycosylation pattern alterations

    • Apoptosis resistance indicators

  • Mechanistic investigations:

    • Determine whether DAD1's contribution to carcinogenesis is primarily through:

      • Apoptosis inhibition

      • Altered glycosylation of cancer-related proteins

      • Other previously uncharacterized functions

  • Validation across cancer types: Confirm whether DAD1's role is specific to hepatocellular carcinoma or extends to other cancer types.

A comprehensive experimental design would combine clinical sample analysis with functional studies in relevant cell and animal models to establish causality rather than mere correlation.

What approaches can resolve contradictory data regarding DAD1 function in different experimental systems?

When facing contradictory results in DAD1 research across different experimental systems, consider the following methodological approaches:

  • System standardization: Implement standardized protocols across different model systems to reduce technical variability.

  • Meta-analysis methodology: When reviewing contradictory published data, employ formal meta-analytical techniques to identify patterns that might explain discrepancies:

Analysis ComponentImplementation
Study inclusion criteriaDefine precise criteria for study quality assessment
Effect size calculationConvert diverse measurements to standardized effect sizes
Heterogeneity assessmentQuantify between-study variance using statistics like I²
Moderator analysisIdentify experimental variables that correlate with outcome differences
  • Independent validation: Replicate key experiments in multiple systems simultaneously using identical protocols and reagents.

  • Context consideration: Systematically evaluate how cellular context influences DAD1 function, particularly examining:

    • Cell type-specific glycosylation requirements

    • Varying apoptotic pathway dependencies

    • Potential compensatory mechanisms

This systematic approach aligns with principles of good experimental design by addressing confounding variables and ensuring repeatability across experimental conditions .

How can DAD1 research inform glycosylation engineering strategies?

Understanding DAD1's role in the oligosaccharyltransferase complex can inform biotechnological approaches to modifying protein glycosylation:

  • Structure-function relationship mapping: Identifying specific DAD1 domains essential for complex assembly and function to guide targeted engineering.

  • Conditional modulation systems: Developing tools to temporarily alter DAD1 activity to achieve specific glycosylation patterns without inducing cell death.

  • Precision glycoengineering: Creating engineered cell lines with modified DAD1 expression or function for producing recombinant glycoproteins with desired glycosylation profiles.

The methodological approach should include comparative analysis of glycosylation patterns under various conditions of DAD1 expression and activity, requiring sophisticated glycan analytical techniques alongside functional assays.

What are the best practices for analyzing species-specific differences in DAD1 function?

When investigating DAD1 across species, researchers should consider:

  • Sequence homology analysis: The high sequence conservation (100% identity between human DAD1 and mouse/rat orthologs in certain regions) suggests functional conservation , but researchers should:

    • Perform comprehensive phylogenetic analysis

    • Identify species-specific post-translational modifications

    • Examine potential differences in interaction partners

  • Cross-species functional complementation: Test whether DAD1 from one species can rescue phenotypes in another species' DAD1-deficient cells.

  • Comparative glycosylation profiling: Analyze N-linked glycosylation patterns across species when DAD1 function is altered.

  • Interaction network mapping: Compare DAD1 protein-protein interactions across species to identify conserved and divergent functional networks.

This comparative approach can provide insights into both fundamental conserved functions and species-specific adaptations of DAD1.

What are the emerging areas of DAD1 research with the greatest potential impact?

Based on current understanding of DAD1 biology, several promising research directions emerge:

  • Therapeutic targeting: Investigating whether modulation of DAD1 function could sensitize cancer cells to apoptosis, particularly in hepatocellular carcinomas showing DAD1 overexpression .

  • Glycosylation disorders: Exploring DAD1's potential role in congenital disorders of glycosylation and developing diagnostic approaches based on DAD1 function.

  • Systems biology integration: Positioning DAD1 within broader networks connecting glycosylation, apoptosis regulation, and cellular stress responses.

  • Structural biology advances: Determining high-resolution structures of DAD1 within the oligosaccharyltransferase complex to enable structure-based functional studies and potential drug design.

These research directions will benefit from interdisciplinary approaches combining molecular biology, structural biology, glycobiology, and clinical research methodologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.