Recombinant Human Dual oxidase maturation factor 1 (DUOXA1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference for your convenience.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
DUOXA1; NIP; NUMBIP; Dual oxidase maturation factor 1; Dual oxidase activator 1; Numb-interacting protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
DUOXA1
Target Protein Sequence
MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTS LFIGAAILAVNFSSEWSVGQVSTNTSYKAFSSEWISADIGLQVGLGGVNITLTGTPVQQL NETINYNEEFTWRLGENYAEEYAKALEKGLPDPVLYLAEKFTPRSPCGLYRQYRLAGHYT SAMLWVAFLCWLLANVMLSMPVLVYGGYMLLATGIFQLLALLFFSMATSLTSPCPLHLGA SVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLKAFFNQSVDEDPMLEWSPEEG GLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL
Uniprot No.

Target Background

Function
May be required for the maturation and transport from the endoplasmic reticulum to the plasma membrane of functional DUOX1.
Gene References Into Functions
  1. Transient overexpression of DUOXA1 impacted cell-cell adhesion by modulating the actin cytoskeleton PMID: 19322654
Database Links

HGNC: 26507

OMIM: 612771

KEGG: hsa:90527

STRING: 9606.ENSP00000267803

UniGene: Hs.356664

Protein Families
DUOXA family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in thyroid gland. Also detected in esophagus.

Q&A

What is the fundamental role of DUOXA1 in DUOX1 function?

DUOXA1 serves as an essential maturation factor that enables DUOX1 to exit the endoplasmic reticulum and become functionally active on the cell surface. The interaction between these two proteins is critical for the generation of hydrogen peroxide (H₂O₂). Studies have demonstrated that intact DUOXA1 is required for the full enzymatic activity of DUOX1, confirming their interdependent relationship in the H₂O₂-generating system .

Functional studies using transfection experiments have shown that cells expressing wild-type DUOX1 alone produce significantly less H₂O₂ compared to cells co-expressing both wild-type DUOX1 and DUOXA1. This highlights the crucial role of DUOXA1 as a cofactor that maximizes DUOX1 catalytic activity .

How is the DUOXA1 gene organized in relation to DUOX1?

The DUOX1 and DUOXA1 genes are arranged in a head-to-head configuration within a compressed genomic locus on chromosome 15. This distinctive genomic organization suggests that the expression of DUOX1 oxidase and its maturation factor DUOXA1 are likely coordinated through a common bidirectional promoter . This genomic arrangement facilitates coordinated regulation of both genes, ensuring appropriate stoichiometric expression levels of these functionally linked proteins.

The complete genomic sequence of DUOXA1 consists of 11 exons, while DUOX1 comprises 35 exons . The shared regulatory elements between these genes highlight their evolutionary coupling and functional interdependence.

What alternative splice variants of DUOXA1 exist and how do they affect function?

Multiple alternative splicing variants of DUOXA1 mRNA have been identified, with significant functional implications. Most notably, variants lacking coding exon 6 generate inactive forms of DUOXA1 . These inactive forms cannot properly facilitate the maturation and transport of DUOX1 to the cell membrane, resulting in impaired H₂O₂ generation.

Research has shown that p38 MAPK plays a role in regulating the splicing of DUOXA1. RNA interference targeting p38 MAPK can counteract the selective up-regulation of DUOXA1 (+ exon 6) mRNA expression induced by irradiation . This suggests that alternative splicing of DUOXA1 may be a regulatory mechanism that modulates H₂O₂ production under different physiological or stress conditions.

How do mutations in DUOXA1 impact H₂O₂ generation and thyroid function?

Mutations in DUOXA1 can significantly impair H₂O₂ generation, with potential clinical consequences such as congenital hypothyroidism (CH). For instance, a heterozygous missense mutation (c.166 C>T; p.R56W) identified in DUOXA1 has been shown to decrease DUOX1 expression at both mRNA and protein levels, with a corresponding reduction in H₂O₂ generation .

Functional studies comparing wild-type and mutant DUOXA1 have demonstrated that the p.R56W mutation results in significantly lower DUOXA1 mRNA expression. Groups with the p.R56W mutant showed dramatically reduced expression compared to groups with wild-type DUOXA1, except for the group expressing only DUOX1 . Furthermore, transfection with the p.R56W mutant substantially inhibited the functional activities of the H₂O₂-generating system, highlighting how genetic defects in DUOXA1 can contribute to pathological conditions such as CH through disruption of the coordinated action of DUOX1 and DUOXA1 .

What is the relationship between radiation exposure, DUOXA1, and cellular responses?

Radiation exposure induces a complex cellular response involving DUOXA1 and DUOX1. After irradiation, both DUOX1 and DUOXA1 are significantly up-regulated several days post-exposure in human thyrocytes, supporting the role of the DUOX1-based NADPH oxidase system in mediating chronic oxidative stress .

The radiation-induced up-regulation of DUOXA1 appears to be dependent on p38 MAPK signaling. Specifically, the selective up-regulation of the active DUOXA1 (+ exon 6) mRNA can be counteracted by RNA interference targeting p38 MAPK . Additionally, H₂O₂ itself can reproduce the effect of irradiation on DUOX1 expression in human thyrocytes, while catalase-mediated H₂O₂ degradation prevents this up-regulation, suggesting a feed-forward mechanism .

Importantly, DUOX1 inactivation affects the level of p38 MAPK phosphorylation analyzed at day 7 post-irradiation, indicating that DUOX1 contributes to the long-term maintenance of radiation-induced effects . This suggests a complex regulatory network involving DUOX1, DUOXA1, and p38 MAPK that perpetuates oxidative stress following radiation exposure.

How does DUOXA1 contribute to radiation-induced genomic instability and tumorigenesis?

DUOXA1, through its role in activating DUOX1, contributes to chronic H₂O₂ production following radiation exposure, which may promote genomic instability and tumorigenesis. Studies have shown that DUOX1 is involved in radiation-induced DNA double-strand breaks (DSBs) in primary thyroid cells, as evidenced by the 50% reduction in DNA-damage foci observed after DUOX1 inactivation .

This relationship is particularly relevant for radiation-induced thyroid tumors. Analysis of thyroid tumor tissues from patients with a history of childhood radiation exposure revealed significantly higher DUOX1 and IL-13 mRNA levels compared to normal thyroid tissues . Immunohistochemistry confirmed overexpression of both proteins in sporadic and radiation-induced thyroid tumors . This suggests that the DUOXA1-DUOX1 system may contribute to tumorigenesis through sustained production of reactive oxygen species, leading to chronic oxidative stress and DNA damage.

What methodologies are most effective for studying DUOXA1 expression and function?

To effectively study DUOXA1 expression and function, researchers should employ a multi-faceted approach:

  • Gene Expression Analysis:

    • Real-time quantitative RT-PCR for measuring mRNA expression levels of DUOXA1 (with and without exon 6) and DUOX1

    • Primer design should account for known splice variants, particularly those lacking exon 6

  • Protein Detection:

    • Western blot analysis using specific antibodies against DUOXA1

    • Immunofluorescence to assess cellular localization patterns

    • Densitometric measurement of protein expression normalized to appropriate housekeeping genes (e.g., β-actin)

  • Functional Assays:

    • H₂O₂ generation assays to measure the functional output of the DUOX1/DUOXA1 system

    • Co-immunoprecipitation studies to assess DUOX1-DUOXA1 protein-protein interactions

  • Genetic Manipulation:

    • RNA interference to downregulate DUOXA1 expression

    • Expression vectors for wild-type and mutant DUOXA1 transfection studies

These methodologies should be combined to provide comprehensive insights into both the expression patterns and functional implications of DUOXA1.

How can researchers accurately measure DUOXA1-mediated H₂O₂ production?

Accurate measurement of H₂O₂ production mediated by the DUOXA1-DUOX1 system requires careful experimental design:

  • Cell Culture Systems:

    • Use appropriate cell lines (e.g., HeLa cells) for transfection studies

    • Consider primary human thyrocytes for physiologically relevant models

  • Transfection Protocols:

    • Transfect cells with expression vectors for wild-type or mutant DUOX1 and DUOXA1

    • Include proper controls: empty vector, single transfections (DUOX1 or DUOXA1 alone), and combination transfections

  • H₂O₂ Detection Methods:

    • Amplex Red assay for extracellular H₂O₂ measurement

    • Intracellular H₂O₂-sensitive fluorescent probes

    • Standardize measurements using H₂O₂ calibration curves

  • Data Analysis:

    • Express results as the mean ± SD of at least three independent experiments performed in triplicate

    • Use appropriate statistical tests to determine significance (e.g., Student's t-test or ANOVA)

  • Validation:

    • Confirm H₂O₂ specificity using catalase treatment as a negative control

    • Correlate H₂O₂ production with DUOX1/DUOXA1 expression levels

This comprehensive approach ensures reliable and reproducible measurements of H₂O₂ production that can be directly attributed to DUOXA1-DUOX1 activity.

What controls should be included when studying DUOXA1 mutations?

When investigating DUOXA1 mutations, researchers should include the following controls to ensure valid and interpretable results:

  • Expression Controls:

    • Wild-type DUOXA1 expression vector

    • Empty vector (negative control)

    • Wild-type DUOX1 expression vector (for co-expression studies)

    • Combinations of wild-type and mutant constructs to assess dominant-negative effects

  • Functional Controls:

    • H₂O₂ production in cells expressing only wild-type DUOXA1

    • H₂O₂ production in cells expressing only wild-type DUOX1

    • H₂O₂ production in cells co-expressing wild-type DUOX1 and DUOXA1

  • Specificity Controls:

    • Catalase treatment to confirm H₂O₂ specificity

    • RNA interference targeting DUOXA1 to confirm knockdown effects

    • Cycloheximide (CHX) chase experiments to assess protein stability

  • Cellular Localization Controls:

    • Endoplasmic reticulum markers to assess retention of DUOX1

    • Cell membrane markers to evaluate proper trafficking

    • Co-localization studies with DUOX1 and DUOXA1

These controls help differentiate between mutations affecting expression, stability, protein-protein interaction, trafficking, or enzymatic activity, providing comprehensive insights into the functional consequences of DUOXA1 mutations.

What methods are recommended for identifying and characterizing DUOXA1 mutations?

For comprehensive identification and characterization of DUOXA1 mutations, researchers should employ the following methodologies:

  • Mutation Screening:

    • PCR amplification of all exons (11 for DUOXA1), including splice and flanking intronic regions

    • DNA sequencing using automated sequencers (e.g., ABI 3730XL)

    • Comparison with reference sequences (e.g., NC_000015.10)

  • Mutation Validation:

    • Screening in control populations to exclude common polymorphisms

    • Family segregation analysis when possible

    • In silico prediction tools to assess potential functional impacts

  • Functional Characterization:

    • Expression studies with mutant constructs

    • mRNA expression analysis using real-time qRT-PCR

    • Protein expression analysis via Western blotting

    • H₂O₂ generation assays

  • Structural Analysis:

    • Protein stability prediction using bioinformatics tools (e.g., ProtScale)

    • Molecular modeling of mutations to predict structural changes

    • Assessment of evolutionary conservation of affected residues

This systematic approach enables thorough characterization of DUOXA1 mutations and their potential pathogenic significance in research and clinical contexts.

How do specific mutations in DUOXA1 affect its interaction with DUOX1?

The interaction between DUOXA1 and DUOX1 is critical for proper function, and specific mutations can disrupt this relationship in various ways:

  • Expression Effects:
    The p.R56W mutation in DUOXA1 decreases both DUOXA1 and DUOX1 expression at mRNA and protein levels. Transfection studies demonstrated that cells expressing this mutation showed significantly reduced DUOXA1 mRNA levels compared to those expressing wild-type DUOXA1 .

  • Protein-Protein Interaction:
    Mutations may disrupt the physical interaction between DUOXA1 and DUOX1, preventing the formation of functional complexes. This is evidenced by the finding that cells co-transfected with mutant DUOXA1 (p.R56W) and mutant DUOX1 (p.R1307Q) showed dramatically reduced DUOX1 protein levels compared to cells with wild-type constructs .

  • Functional Output:
    The ultimate consequence of disrupted DUOXA1-DUOX1 interaction is impaired H₂O₂ generation. Experiments showed that transfection with both mutants (p.R1307Q and p.R56W) in combination impaired the H₂O₂-generating system to the maximum extent compared to all other experimental conditions .

  • Protein Stability:
    While some mutations may affect protein stability, the p.R1307Q mutation in DUOX1 did not appear to alter protein stability based on cycloheximide chase experiments and ProtScale predictions .

These findings highlight the complex interplay between DUOXA1 and DUOX1, demonstrating that mutations can disrupt this partnership through multiple mechanisms, ultimately affecting H₂O₂ production and related physiological processes.

What is the evidence linking DUOXA1 mutations to congenital hypothyroidism?

Evidence linking DUOXA1 mutations to congenital hypothyroidism (CH) has emerged from both genetic and functional studies:

  • Genetic Evidence:
    A heterozygous missense mutation (c.166 C>T; p.R56W) was identified in DUOXA1 in a patient with CH after excluding mutations in other genes known to cause CH, including DUOX2, DUOXA2, TPO, TG, and NIS .

  • Functional Evidence:
    Experimental studies demonstrated that the p.R56W mutation in DUOXA1 decreased DUOX1 expression at both mRNA and protein levels, with a corresponding impairment in H₂O₂ generation. Since H₂O₂ is essential for thyroid hormone synthesis, this functional defect provides a plausible mechanistic link to CH .

  • Monoallelic Effects:
    Interestingly, the patient harboring the DUOXA1 mutation presented with CH despite having only a heterozygous mutation. This suggests that monoallelic DUOXA1 mutations, similar to what has been observed with DUOX2 and DUOXA2, may be sufficient to cause CH .

  • Combined Genetic Effects:
    The researchers also proposed that there may be concurrent genetic alterations in other relevant genes that haven't been examined in the patients, potentially contributing to the disease phenotype through digenic or oligogenic inheritance patterns .

These findings expand our understanding of the genetic etiology of CH and highlight DUOXA1 as a novel candidate gene for this condition, with implications for genetic testing and counseling.

How might DUOXA1 expression changes contribute to radiation-induced thyroid tumors?

DUOXA1 expression changes appear to play a significant role in radiation-induced thyroid tumorigenesis through several mechanisms:

  • Chronic Oxidative Stress:
    Radiation exposure leads to upregulation of both DUOX1 and DUOXA1 in thyroid cells, contributing to chronic H₂O₂ production and oxidative stress. This persistent oxidative environment can drive genomic instability and promote tumor progression .

  • Molecular Evidence:
    Analysis of thyroid tumor tissues from patients with a history of childhood radiation exposure revealed significantly higher DUOX1 and IL-13 mRNA levels compared to normal thyroid tissues. Immunohistochemistry confirmed overexpression of both proteins in radiation-induced thyroid tumors .

  • DNA Damage Mechanism:
    DUOX1, activated by DUOXA1, is involved in radiation-induced DNA double-strand breaks (DSBs). Experiments demonstrated that DUOX1 inactivation led to a 50% reduction in DNA-damage foci in irradiated cells, suggesting that DUOX1-generated H₂O₂ contributes directly to genomic damage .

  • Self-Perpetuating Cycle:
    H₂O₂ itself can reproduce the effect of irradiation on DUOX1 expression, and DUOX1 inactivation affects p38 MAPK phosphorylation, indicating that DUOX1 contributes to long-term maintenance of radiation-induced effects. This creates a self-perpetuating cycle of oxidative stress that may promote tumorigenesis long after the initial radiation exposure .

These findings suggest that targeting the DUOXA1-DUOX1 system might be a potential strategy for preventing or treating radiation-induced thyroid tumors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.