Recombinant Human Dual specificity protein phosphatase CDC14C (CDC14C)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cell Cycle Regulation

CDC14C belongs to the evolutionarily conserved Cdc14 phosphatase family, which regulates mitotic exit and cytokinesis by counteracting cyclin-dependent kinase (CDK) activity . Key inferred roles include:

  • Mitotic Exit: Dephosphorylation of CDK targets (e.g., proteins with pSer/Thr-Pro motifs) to reset the cell cycle .

  • DNA Damage Response: Interaction with repair proteins (e.g., resolvases, spindle pole body components) suggests a role in maintaining genome stability .

  • Substrate Specificity: Preferential dephosphorylation of proline-directed kinase targets, a hallmark of CDK-regulated pathways .

Current Uses:

  • Biochemical Assays: Study phosphatase kinetics and substrate preferences using recombinant CDC14C .

  • Cell Cycle Studies: Investigate its role in mitosis, cytokinesis, or DNA repair through overexpression or knockdown models .

Knowledge Gaps:

  • Substrate Profile: No direct substrates of CDC14C have been identified in the provided literature, unlike its paralogs (e.g., CDC14A/B) .

  • Disease Relevance: While CDC14A/B are linked to cancer and centrosome defects , CDC14C’s pathophysiological roles remain uncharacterized.

Comparative Analysis with Other Cdc14 Family Members

FeatureCDC14CCDC14ACDC14B
Subcellular LocalizationUndefinedCytoplasm, centrosomesNucleolus, midbody
Known SubstratesNone reportedCdk1 targets, Sfi1Cdk1 targets, Cdc20
Disease AssociationsUnknownCancer (reduced expression in tumors) Aneuploidy, mitotic defects

Future Directions

  • Structural Studies: High-resolution crystallography or cryo-EM to resolve CDC14C’s active site and regulatory interfaces.

  • Functional Screens: Identification of physiological substrates using phosphoproteomics or synthetic genetic arrays.

  • Therapeutic Exploration: Assess CDC14C’s potential as a target in disorders linked to cell cycle dysregulation.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please communicate with us and we will prioritize the development of the specified tag.
Synonyms
CDC14C; CDC14B2; CDC14Bretro; Dual specificity protein phosphatase CDC14C; CDC14 cell division cycle 14 homolog C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-554
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
CDC14C
Target Protein Sequence
MNEVSSECGKKCEPLGCSSTNGDLQGEAGAVVSIFLRMVPRIKSNEGYGYSNRNWRKENT MHSLDRNIVDGGQALGQWKRKSKGRSSWAAAPHCSPRCSLTSQGVKKMRSSTLQDPRRRD PQDDVYVDITDRLRFAILYSRPKSASNVHYFSIDNELEYENFSEDFGPLNLAMVYRYCCK INKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEAAYRILIFGDTPYI PFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDR FIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDL FFADGSTPTDAIVKRFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAW VRICRPGLVIGPQQQFLVMKQTSLWLEGDYFRQRLKGQENGQHRAAFSKLLSGVDDISIN GVENQDQQEPKPYSDDDEINGVTQGDRSRALKRRRQSKTNDILLPSPLAVLTFTLCSVVI WWIVCDYILPILLF
Uniprot No.

Target Background

Function
Dual-specificity phosphatase. Preferentially dephosphorylates proteins modified by proline-directed kinases.
Database Links

HGNC: 22427

UniGene: Hs.567757

Protein Families
Protein-tyrosine phosphatase family, Non-receptor class CDC14 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is CDC14C and how does it relate to other CDC14 family members?

CDC14C belongs to the CDC14 family of dual-specificity phosphatases that dephosphorylate serine/threonine phosphorylated residues. In humans, the CDC14 family includes CDC14A, CDC14B, and CDC14C. These phosphatases are evolutionarily conserved from yeast to humans, though their functions have diverged. While CDC14 is essential for mitotic exit in yeast, mammalian CDC14 phosphatases have evolved additional roles in cellular differentiation and development . CDC14C shares structural features with CDC14A and CDC14B, including the conserved phosphatase catalytic domain and similar substrate recognition mechanisms.

What are the typical expression patterns of CDC14C in human tissues?

While specific CDC14C expression data is limited, studies of human CDC14 family members indicate that CDC14A and CDC14B are predominantly expressed in the brain among adult tissues . Research suggests that CDC14 phosphatases may have tissue-specific functions, particularly in neural development, as evidenced by the neural developmental defects observed in CDC14-deficient mouse models . When designing experiments with CDC14C, researchers should consider these tissue-specific expression patterns.

What is the substrate specificity of CDC14C compared to other CDC14 family members?

CDC14 phosphatases demonstrate a strong and unusual preference for phosphoserine over phosphothreonine at proline-directed sites . This specificity is mediated by an invariant active site alanine residue that sterically restricts phosphothreonine binding . Optimal CDC14 substrates typically possess a basic residue at the +3 position relative to the phosphoserine, whereas substrates lacking this basic residue are not effectively hydrolyzed . For CDC14C specifically, researchers should validate whether it maintains the same substrate preferences as other family members through in vitro dephosphorylation assays with synthetic peptides containing either phosphoserine or phosphothreonine residues in various sequence contexts.

How does CDC14C contribute to cellular differentiation processes?

Recent research has revealed that mammalian CDC14 phosphatases play critical roles in the exit from stemness and differentiation of pluripotent cells along the neural lineage . CDC14 phosphatases dephosphorylate the epigenetic regulator UTF1, inducing its degradation during exit from stemness . This destabilization is accompanied by de-repression of bivalent promoters required for neural cell differentiation . To investigate CDC14C's specific role in differentiation, researchers should consider knockdown/knockout approaches in pluripotent stem cell models, followed by differentiation assays and analysis of UTF1 levels and target gene expression.

What are the optimal conditions for recombinant CDC14C expression and purification?

Based on protocols used for other CDC14 family members, recombinant CDC14C can be expressed using bacterial, insect, or mammalian expression systems. For bacterial expression, the catalytic domain can be cloned into pET vectors with an N-terminal His-tag or GST-tag for purification. Expression in E. coli BL21(DE3) at lower temperatures (16-18°C) after IPTG induction often yields better soluble protein. Purification typically involves affinity chromatography followed by size exclusion chromatography in buffers containing reducing agents to maintain the active site cysteine in a reduced state.

For immunopurification of CDC14C from mammalian cells, protocols similar to those used for other CDC14 family members can be adapted. This would involve extracting cells in buffer containing 20 mM K-HEPES, pH 7.4, 110 mM K-acetate, 0.1% Tween 20, with protease inhibitors, followed by incubation with antibody-conjugated beads .

How can I assess CDC14C phosphatase activity in vitro?

Phosphatase activity of recombinant CDC14C can be measured using synthetic phosphopeptides as substrates. Based on the known preference of CDC14 family members, peptides containing phosphoserine in a Ser(P)-Pro-X-Lys/Arg context would be optimal substrates . Activity assays typically involve incubating the enzyme with substrate at 30°C in a buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 1 mM EDTA, and 1 mM DTT. Released phosphate can be detected using malachite green-based colorimetric assays or by mass spectrometry for more detailed analyses.

When testing potential physiological substrates, compare peptides containing Ser(P) versus Thr(P) to verify if CDC14C maintains the strong serine preference observed in other family members . Include control reactions with the phosphatase-dead mutant (typically created by mutating the active site cysteine to serine) to confirm specificity.

How can I identify novel CDC14C substrates in cellular contexts?

To identify CDC14C substrates, researchers can employ several complementary approaches:

  • Affinity purification coupled with mass spectrometry: Express tagged CDC14C in cells and isolate interacting proteins. Prior studies with CDC14 successfully identified substrates using this approach . To increase sensitivity, use catalytically inactive substrate-trapping mutants (e.g., CDC14C-C/S mutant) that bind but do not release substrates .

  • Phosphoproteomic analysis: Compare phosphoprotein profiles between CDC14C-overexpressing cells, CDC14C-depleted cells, and controls. Focus on phosphosites containing the CDC14 consensus motif (Ser-Pro-X-Lys/Arg) .

  • Candidate-based approaches: Test known substrates of other CDC14 family members. For example, examine UTF1 phosphorylation status, as it has been identified as a substrate for mammalian CDC14 phosphatases .

What is the role of CDC14C in neural development and differentiation?

Studies of CDC14-deficient mouse models have revealed critical roles for CDC14 phosphatases in neural development. Mice lacking both CDC14A and CDC14B display perinatal lethality with specific defects in brain development, including alterations in the cerebellar vermis structure, enlarged external granule layer (EGL), and decreased molecular layer (ML) . CDC14-deficient embryonic stem cells show impaired neural differentiation with defective de-repression of bivalent promoters required for neural differentiation .

To investigate CDC14C's specific role in neural development:

  • Generate CDC14C-specific knockdown/knockout in neural progenitor cells

  • Perform neural differentiation assays and analyze marker expression by immunofluorescence and transcriptomics

  • Examine UTF1 phosphorylation status and stability, as well as the expression of UTF1 target genes

  • Analyze chromatin accessibility at bivalent promoters using ATAC-seq in CDC14C-depleted versus control cells during differentiation

Why might recombinant CDC14C show reduced phosphatase activity?

Several factors can contribute to reduced activity of recombinant CDC14C:

  • Oxidation of the catalytic cysteine: CDC14 phosphatases contain a catalytic cysteine that is susceptible to oxidation. Ensure buffers contain reducing agents like DTT or TCEP throughout purification and storage.

  • Improper folding: If expressing in bacteria, lower induction temperatures (16-18°C) and co-expression with chaperones can improve folding.

  • Post-translational modifications: Recombinant CDC14C produced in bacterial systems lacks mammalian post-translational modifications that might be required for full activity. Consider using mammalian or insect cell expression systems if bacterial expression yields low activity enzyme.

  • Substrate specificity: CDC14 phosphatases have strict substrate preferences. Ensure test substrates contain phosphoserine (not phosphothreonine) in a Ser(P)-Pro-X-Basic context .

How can I improve the detection of CDC14C-substrate interactions in cells?

Detecting CDC14C-substrate interactions can be challenging due to their often transient nature. To improve detection:

  • Use substrate-trapping mutants: The catalytically inactive C→S mutant of CDC14C can form more stable complexes with substrates.

  • Optimize cell lysis conditions: Based on protocols used for other CDC14 family members, extract cells in buffers containing 20 mM K-HEPES (pH 7.4), 110 mM K-acetate, 0.1-0.25% Tween 20 or Triton X-100, and 200-250 mM NaCl .

  • Crosslinking approaches: Prior to lysis, treat cells with membrane-permeable crosslinkers to stabilize transient interactions.

  • Manipulate CDC14C localization: CDC14 phosphatases are regulated by subcellular localization, with sequestration in the nucleolus being a common mechanism . Consider studying cells where CDC14C is released from sequestration to enhance substrate accessibility.

How do genetic CDC14C alterations affect cellular differentiation compared to CDC14A/B deficiency?

While the specific effects of CDC14C alterations are not well-characterized, studies of CDC14A/B double knockout mice provide insights into potential phenotypes. CDC14A/B-deficient embryonic stem cells show:

  • Normal cell cycle exit and proliferation but impaired neural differentiation

  • Altered expression of pluripotency factors, with incomplete downregulation or even upregulation of stem cell proteins upon differentiation signals

  • Defective de-repression of bivalent promoters required for neural differentiation

  • Abnormal UTF1 regulation, affecting epigenetic control of differentiation

To determine CDC14C-specific effects, researchers should generate CDC14C knockdown/knockout models and compare their phenotypes with CDC14A/B deficiency, particularly examining neural differentiation capacity, UTF1 phosphorylation status, and transcriptional changes at bivalent promoters.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.