Recombinant Human Dynamin-like 120 kDa protein, mitochondrial (OPA1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
OPA1; KIAA0567; Dynamin-like 120 kDa protein, mitochondrial; Optic atrophy protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
195-960
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
OPA1
Target Protein Sequence
ATDRGSESDKHFRKVSDKEKIDQLQEELLHTQLKYQRILERLEKENKELRKLVLQKDDKG IHHRKLKKSLIDMYSEVLDVLSDYDASYNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIF PRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEG CTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIIL CIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMK ALGYFAVVTGKGNSSESIEAIREYEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWK MVRESVEQQADSFKATRFNLETEWKNNYPRLRELDRNELFEKAKNEILDEVISLSQVTPK HWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAW ETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRS ISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNE LEKMLKCNEEHPAYLASDEITTVRKNLESRGVEVDPSLIKDTWHQVYRRHFLKTALNHCN LCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVL EDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK
Uniprot No.

Target Background

Function
Dynamin-related GTPase crucial for maintaining normal mitochondrial morphology by regulating the balance between mitochondrial fusion and fission. Optimal activity in promoting mitochondrial fusion requires co-expression of isoform 1 with shorter alternative products. It binds lipid membranes rich in negatively charged phospholipids (e.g., cardiolipin), inducing membrane tubulation. Its intrinsic GTPase activity is low but significantly increases upon lipid membrane interaction. OPA1 plays roles in cristae remodeling and cytochrome c release during apoptosis. Proteolytic processing in response to intrinsic apoptotic signals can lead to OPA1 oligomer disassembly and cytochrome c (CYCS) release into the mitochondrial intermembrane space, activating caspases. It also contributes to mitochondrial genome maintenance. An inactive form, produced by OMA1 cleavage at the S1 site under stress conditions causing mitochondrial membrane potential loss, negatively regulates mitochondrial fusion. Isoforms containing the alternative exon 4b (isoforms 4 and 5) are essential for mitochondrial genome maintenance, potentially by anchoring mitochondrial nucleoids to the inner mitochondrial membrane.
Gene References Into Functions
  1. The LEU396ARG mutation in OPA1 is associated with severe dominant optic atrophy. PMID: 29350691
  2. OPA1 gene therapy prevents retinal ganglion cell loss in a dominant optic atrophy mouse model. PMID: 29410463
  3. A human iPSC line (IISHDOi003-A) was generated from fibroblasts of a patient with a dominant optic atrophy 'plus' phenotype, carrying a heterozygous mutation (c.1635C>A; p.Ser545Arg) in the OPA1 gene. PMID: 29034899
  4. OPA1, a dynamin-related GTPase, controls mitochondrial dynamics, cristae integrity, energetics, and mitochondrial DNA maintenance; eight isoforms have been characterized. (Review) PMID: 29382469
  5. This study assessed the afferent visual system and OCT in an Italian cohort of 52 ADOA probands with OPA1 mutations and 8 asymptomatic carriers. Visual acuity and OCT data in missense mutations were compared with those causing haploinsufficiency and correlated with age in both groups. PMID: 29111013
  6. The SIRT4-OPA1 axis is causally linked to mitochondrial dysfunction and altered mitochondrial dynamics, resulting in aging-associated decreased mitophagy due to an unbalanced mitochondrial fusion/fission cycle. PMID: 29081403
  7. This study demonstrates genotype-phenotype correlations between OPA1 mutation types and mitophagy. PMID: 28378518
  8. A metabolic shift from glycolysis in young to mitochondrial respiration in old normal human fibroblasts occurs during chronological lifespan, and MFN1 and OPA1 regulate this process. PMID: 28758339
  9. Disease-causing mutations were identified in 34% of referred cases, mostly in OPA1. OPA1 mutations were more prevalent in patients with a family history, but 30.4% of patients without a family history also had OPA1 mutations. PMID: 28848318
  10. OPA1 gene mutations were identified in Han Chinese patients with suspected optic neuropathy. PMID: 26867657
  11. Identifying genomic rearrangements or pathogenic variants of OPA1 is crucial for disease prognosis and genetic counseling in DOA. PMID: 28668999
  12. In brown adipocytes, evidence suggests that OPA1 regulation of fission increases thermogenesis, contributing to energy dissipation. PMID: 28427098
  13. OPA1 stabilization impedes cristae remodeling. PMID: 28228254
  14. This study provides a model for mammalian cristae biogenesis by OPA1 and MICOS, integrating proteomics, biochemistry, genetics, and electron tomography. PMID: 27974214
  15. A splice site mutation (c.985G>T) caused exon 10 skipping (c.985_1065del, p.V329_D355del), suggesting loss-of-function of the OPA1 GTPase domain and likely haploinsufficiency, a major DOA mechanism. PMID: 26854526
  16. This study identifies a novel pathogenic OPA1 mutation in a transcript region not susceptible to NMD activation. PMID: 28841713
  17. OPA1 gene screening in patients with bilateral optic atrophy is important for clinical diagnosis. PMID: 27860320
  18. OPA1 and cardiolipin cooperate in heterotypic mitochondrial inner membrane fusion. PMID: 28628083
  19. OPA1 stabilizes respiratory chain supercomplexes, enabling respiring mitochondria to compensate for decreased Deltapsim via a rapid matrix pH flash. PMID: 28174208
  20. This study reports the first genetically confirmed OPA1-related autosomal-dominant optic atrophy cases from Singapore, including a novel mutation causing 'ADOA plus' syndrome. PMID: 27858935
  21. Contrary to previous assumptions, S-OPA1 is fully capable of maintaining mitochondrial energetics and cristae structure. PMID: 28298442
  22. Analysis of a multicenter OPA1 patient cohort revealed that women experience more severe visual loss in adolescence and greater progressive retinal nerve fiber thinning than men. This study identifies a gender-dependent effect on ADOA severity, involving steroids and Müller glial cells in RGC degeneration. PMID: 27260406
  23. While the architecture of dendritic arborization in patients with OPA1 mutations is unknown, data suggest that loss of dendritic arborization, not just neuronal loss, may be involved in DOA pathogenesis. PMID: 28125838
  24. A de novo heterozygous deletion (c.2012+4_2012+7delAGTA) causing exon 18 and 19 skipping was identified, absent in healthy family members. PMID: 28245802
  25. Increased mitophagy and excessive mitochondrial fragmentation were observed in primary human cultures with DOA plus due to biallelic OPA1 mutations. PMID: 27974645
  26. Novel compound heterozygous OPA1 mutations were identified in a patient with recessive optic atrophy, sensorimotor neuropathy, and congenital cataracts, expanding the clinical spectrum of OPA1-associated pathologies. PMID: 27150940
  27. Whole-exome sequencing identified a novel de novo OPA1 mutation in a patient with isolated optic atrophy. PMID: 27265430
  28. This study reveals a new regulatory mechanism of mitochondrial fusion proteins, Mfns degradation or OPA1 processing, in response to mitochondrial morphology. PMID: 26935475
  29. Pathogenic OPA1 mutations cause increased mitochondrial fragmentation, leading to unstable mitochondrial respiratory chain complexes. PMID: 27585216
  30. Hearing impairment in patients with OPA1 missense mutations is associated with disordered auditory nerve fiber activity synchrony due to neural degeneration affecting terminal dendrites. PMID: 25564500
  31. Cleavage of the inner membrane fusion factor L-OPA1 is prevented due to the failure to activate the inner membrane protease OMA1 in mitochondria with collapsed membrane potential. PMID: 24634514
  32. This study describes a novel mechanism where OPA1 senses energy substrate availability, modulating its function in mitochondrial architecture regulation in an SLC25A protein-dependent manner. PMID: 25298396
  33. OMA1 processing is positively correlated with OPA1 cleavage at the S1 site and the regulation of mitochondrial morphology. PMID: 24719224
  34. LHON-mtDNA mutations are the most common genetic defects, followed by OPA1 mutations, in this Chinese cohort. PMID: 25205859
  35. This study shows that (a) p53 and Oma1 mediate L-Opa1 processing, (b) mitochondrial fragmentation is involved in CDDP-induced apoptosis in OVCA and CECA cells, and (c) dysregulated mitochondrial dynamics. PMID: 25112877
  36. Four cases of children with Behr syndrome and heterozygous OPA1 mutations are reported. PMID: 25012220
  37. This study provides information on the genotype-phenotype correlation and the role of the OPA1 gene in Greek patients with autosomal dominant optic atrophy. PMID: 24883014
  38. Approximately 20% of patients with OPA1 gene mutations exhibit symptoms of multiple system disease, including peripheral neuropathy. (Review) PMID: 25137924
  39. Two heterozygous OPA1 missense mutations (p.T414P and p.T540P) in the GTPase and middle domains were associated with autosomal dominant optic atrophy and auditory neuropathy spectrum disorder. PMID: 26905822
  40. A causal link between a homozygous OPA1 mutation and hypertrophic cardiomyopathy with optic atrophy was established, highlighting OPA1's role in mitochondrial biogenesis and mtDNA maintenance. PMID: 26561570
  41. OPA1 variants increase leprosy risk in the Chinese Han population, potentially affecting OPA1 expression, mitochondrial function, and antimicrobial pathways. PMID: 26360011
  42. Genotype-phenotype heterogeneity in OPA1 autosomal-dominant optic atrophy (ADOA) is evident in inner retinal atrophy as a function of age. PMID: 26385429
  43. A heterozygous mutation in OPA1 disrupts the GTPase domain and is associated with variably expressed ADOA Plus. PMID: 26194196
  44. Copy number variation in the OPA1 gene was identified in a Chinese pedigree. PMID: 26400325
  45. Physiological OPA1 levels are crucial for cardiovascular health by maintaining mitochondrial shape and respiratory function; downregulation is linked to cardiovascular disease. (Review) PMID: 25557256
  46. Increased apoptosis in autosomal dominant optic atrophy patients suggests susceptibility to oxidative stress and a correlation between OPA1 protein dysfunction and mitochondrial alterations; mutated protein sensitivity to free radical damage is implied. PMID: 25796301
  47. Abnormal diffusivity indexes might reflect abnormal intracellular mitochondrial morphology and altered protein levels due to OPA1 mutations. PMID: 25794858
  48. A recurrent deletion mutation in OPA1 causes autosomal dominant optic atrophy in a Chinese family. PMID: 25374051
  49. Two heterozygous OPA1 missense mutations (p.G488R, p.A495V) were associated with chronic progressive external ophthalmoplegia, parkinsonism, and dementia in two Italian families. PMID: 25820230
  50. OPA1 mutations induced mitochondrial fragmentation, uncoupled mitochondrial respiration, and dysfunctional bioenergetics. PMID: 25744979
Database Links

HGNC: 8140

OMIM: 125250

KEGG: hsa:4976

STRING: 9606.ENSP00000354681

UniGene: Hs.594504

Involvement In Disease
Optic atrophy 1 (OPA1); Dominant optic atrophy plus syndrome (DOA+); Behr syndrome (BEHRS); Mitochondrial DNA depletion syndrome 14, cardioencephalomyopathic type (MTDPS14)
Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein. Mitochondrion intermembrane space. Mitochondrion membrane.
Tissue Specificity
Highly expressed in retina. Also expressed in brain, testis, heart and skeletal muscle. Isoform 1 expressed in retina, skeletal muscle, heart, lung, ovary, colon, thyroid gland, leukocytes and fetal brain. Isoform 2 expressed in colon, liver, kidney, thyr

Q&A

What is the molecular structure and function of OPA1?

OPA1 is a dynamin-related protein with a molecular weight of approximately 120 kDa. The protein contains an NH2-terminal GTPase domain followed by a conserved middle domain and a putative helical domain called the assembly domain . Like other dynamin family members, OPA1 has divergent segments that likely determine its specific functions.

Methodologically, OPA1's function can be studied through:

  • Protein domain analysis: The GTPase domain is particularly critical, as mutations in this region (such as K38A) result in dominant-negative effects on mitochondrial morphology .

  • Subcellular localization studies: OPA1 localizes to the inner mitochondrial membrane (IMM), where it regulates mitochondrial fusion and cristae structure.

  • Functional assays: OPA1 is involved in mitochondrial fusion, oxidative phosphorylation, maintenance of mitochondrial DNA, and apoptosis regulation .

Unlike other dynamin family members that function in membrane traffic (like dynamin and yeast vacuolar protein sorting factor), OPA1 specifically regulates mitochondrial dynamics without affecting the morphology of other organelles or transport pathways .

What are the key OPA1 isoforms and how are they utilized in research?

The OPA1 gene consists of 31 exons that produce 8 mRNA isoforms through alternative splicing of exons 4, 4b, and 5b . When designing experiments with recombinant OPA1, researchers should consider:

Table 1: Comparison of Key OPA1 Isoforms Used in Research

IsoformKey FeaturesResearch ApplicationsExpression Considerations
Isoform 1Commonly used in experimental studiesRestoration of mtDNA levels, cristae reorganization, and electron transport chain functionCan be codon-optimized for enhanced expression
Isoform 7Contains alternatively spliced exon 5bSimilar functional restoration as isoform 1; contains YME1L cleavage siteCodon optimization improves expression in heterologous systems

Both isoforms have been successfully employed to restore mitochondrial morphology in OPA1 knockout cells, converting fragmented mitochondria back to tubular networks . Experimental evidence shows that cells transfected with either optimized OPA1 isoform 1 or 7 demonstrate tubular mitochondrial networks, indicating restoration of mitochondrial fusion .

Importantly, OPA1 mRNA isoforms show tissue-specific expression patterns, which should be considered when selecting isoforms for research in specific tissue contexts .

What methods are recommended for detecting and quantifying OPA1 expression?

Reliable detection and quantification of OPA1 expression is crucial for experimental reproducibility. Standard methodological approaches include:

  • RNA quantification via RT-PCR:

    • Design primers targeting all 8 endogenous OPA1 mRNA isoforms (e.g., F 5′-AGTAGAGGTTGCTTGGGAGAC-3′ and R 5′-TGTCATCATGCTCTTTCCCT-3′)

    • For optimized recombinant constructs, use specific primers (e.g., F 5′-TACCCCAGACTGAGAGAGCT-3′ and R 5′-ACTTGGCTCAGGGAGATCAC-3′)

    • Employ β-actin as an endogenous control

    • Generate standard curves from plasmids with known copy numbers to obtain absolute quantification

  • Protein detection via immunofluorescence:

    • Fix cells with 4% paraformaldehyde for 20 minutes at room temperature

    • Block with 5% Donkey Serum and 0.3% Triton in PBS for 2 hours

    • For tagged recombinant OPA1, use specific antibodies (e.g., Anti-6xHIS at 1:500 dilution)

    • Counterstain nuclei with DAPI (1:50,000 in PBS for 10 min)

  • Stable cell line generation:

    • Clone OPA1 isoforms into expression vectors (e.g., pcDNA3.1)

    • Transfect target cells (such as OPA1-/- MEFs)

    • Select with appropriate antibiotics (e.g., 200 μg/ml G418)

    • Isolate single-cell colonies and verify expression

When analyzing OPA1 expression, researchers must consider both long (l-form) and short (s-form) variants, as both forms are required to fully restore wild-type mitochondrial physiology .

How do mutations in OPA1 affect mitochondrial function?

OPA1 mutations produce distinct effects on mitochondrial morphology and function that can be studied through various experimental approaches:

  • Morphological analysis:

    • In cells expressing mutant OPA1 (particularly GTPase domain mutants), mitochondrial tubular projections retract into large perinuclear aggregates

    • By electron microscopy, these aggregates appear as clusters of tubules rather than a large mass of coalescing membrane

    • Visualization can be achieved using mitochondrial markers followed by fluorescence microscopy

  • Quantitative assessment:

    • Cells can be grouped by mitochondrial phenotype (punctate or rescued)

    • OPA1 fluorescence levels correlate with mitochondrial morphology

    • Statistical analysis can be used to determine the relationship between OPA1 expression levels and mitochondrial phenotype

  • Pathogenic effects:

    • Most mutations causing optic atrophy type 1 create premature stop signals, resulting in unstable, truncated proteins

    • These mutations lead to misshapen, disorganized mitochondria with reduced energy-producing capabilities

    • The most common mutation in Danish populations is a single nucleotide deletion (2826delT)

The clinical spectrum of OPA1 mutations extends beyond visual impairment, with up to 20% of mutation carriers developing extra-ocular neurological complications including sensorineural deafness, ataxia, myopathy, peripheral neuropathy, and progressive external ophthalmoplegia .

How do different OPA1 isoforms contribute to mitochondrial dynamics and function?

Understanding the specific contributions of OPA1 isoforms requires sophisticated experimental approaches:

Table 2: Functional Contributions of OPA1 Forms

OPA1 FormGeneration MechanismFunctional RoleResearch Implications
Long form (l-form)Full-length translation productPrimarily involved in mitochondrial fusionExpression of l-form alone provides partial functional restoration
Short form (s-form)Proteolytic cleavage by OMA1 (exon 5) or YME1L (exon 5b)Contributes to fusion and mtDNA maintenanceExpression of s-form alone provides partial functional restoration
Combined formsNatural processing in wild-type cellsComplete mitochondrial physiologyBoth forms required for full functional restoration

Methodologically, researchers can investigate isoform-specific functions through:

  • Isoform-specific rescue experiments:

    • Generate cellular models lacking endogenous OPA1 (e.g., OPA1-/- MEFs)

    • Introduce individual OPA1 isoforms through transfection

    • Assess restoration of mitochondrial morphology and function

  • Processing and cleavage studies:

    • Analyze the generation of s-forms from l-forms by OMA1 and YME1L proteases

    • Investigate the balance between forms under different cellular conditions

    • Evaluate the impact of mutations on processing efficiency

Research has shown that expression of any of the eight isoforms can restore mtDNA levels, reorganize cristae, and improve electron transport chain function, but both l and s-forms are needed to fully restore wild-type mitochondrial physiology .

What are the optimal experimental designs for studying OPA1 in neurodegenerative disease models?

OPA1 mutations cause dominant optic atrophy (DOA) and can lead to multi-system neurological disease in DOA+ variants. When designing experiments to study OPA1 in neurodegenerative contexts:

  • Model selection considerations:

    • Patient-derived cells carrying pathogenic OPA1 mutations

    • Transgenic animal models (e.g., Opa1 delTTAG/+ mouse model)

    • In vitro models with specific OPA1 mutations or knockdown

  • Therapeutic intervention strategies:

    • AAV-delivered OPA1 (particularly isoform 1) has shown significant protection of retinal ganglion cells (RGCs) in Opa1 delTTAG/+ mice

    • OPA1 delivery has demonstrated benefit in laser-induced glaucoma models and chemical models of ocular mitochondrial uncoupling

    • Constitutively expressing OPA1 mice showed increased mitochondrial supercomplex formation and protection from reperfusion ischemia damage

  • Phenotypic assessment:

    • Visual function testing

    • RGC survival quantification

    • Mitochondrial function analysis in neuronal populations

    • Assessment of other neurological symptoms in DOA+ variants

Recent studies have demonstrated that l-form OPA1 can alleviate acute ischemic stroke injury in rat brain, preventing neuronal cell loss . Additionally, AAV-delivered OPA1 isoform 1 has shown protection in multiple models of optic neuropathy, though improvements in visual acuity may not always reach statistical significance .

How can researchers reconcile contradictory data on OPA1 function across different experimental systems?

When encountering contradictory results regarding OPA1 function, consider these methodological approaches to reconcile discrepancies:

  • Expression level assessment:

    • Cells exhibit distinct mitochondrial phenotypes based on OPA1 expression levels

    • Quantitative analysis shows that cells with punctate mitochondria have significantly different OPA1 expression compared to cells with rescued tubular networks

    • Establish dose-response relationships between OPA1 levels and functional outcomes

  • Isoform and processing considerations:

    • Different studies may utilize different OPA1 isoforms

    • The processing of l-form to s-form may vary between experimental systems

    • The ratio between forms affects functional outcomes

  • Model-specific factors:

    • Cell type and tissue origin influence OPA1 function

    • The presence of endogenous OPA1 may confound results

    • The metabolic state and energy demands of the experimental system

  • Mutation-specific effects:

    • Different OPA1 mutations exhibit variable penetrance and expressivity

    • Multi-system neurological features affect approximately 20% of OPA1 mutation carriers

    • Missense mutations may carry increased risk for extra-ocular complications (odds ratio = 3.06, 95% CI = 1.44–6.49)

When comparing studies, carefully evaluate the experimental variables, including the specific mutations, expression systems, and phenotypic assessments used.

What methodological approaches are recommended for investigating OPA1's role in mitochondrial DNA maintenance?

OPA1 plays a critical role in maintaining mitochondrial DNA (mtDNA). To effectively study this function:

Table 3: Experimental Approaches for Studying OPA1's Role in mtDNA Maintenance

Research QuestionMethodological ApproachKey MeasurementsTechnical Considerations
mtDNA quantityQuantitative PCRRatio of mitochondrial to nuclear DNAMultiple mtDNA targets; appropriate controls
mtDNA integrityLong-range PCR; sequencingDetection of deletions and mutationsTemplate quality; specialized polymerases
mtDNA distributionFluorescence microscopyNucleoid size and distributionResolution limitations; specific DNA dyes
Functional consequencesRespirometry; enzyme assaysOxygen consumption; complex activitiesCell density; substrate selection

Research has demonstrated that expression of OPA1 isoforms can restore mtDNA levels in OPA1 knockout cells . To thoroughly investigate this function:

  • Establish baseline measurements:

    • Determine mtDNA copy number in control and experimental conditions

    • Assess mtDNA integrity and nucleoid organization

    • Measure mitochondrial respiratory function

  • Conduct rescue experiments:

    • Introduce wild-type or mutant OPA1 into deficient systems

    • Monitor changes in mtDNA parameters over time

    • Correlate mtDNA restoration with functional recovery

  • Investigate mechanism:

    • Examine the relationship between mitochondrial fusion and mtDNA maintenance

    • Assess nucleoid organization in relation to cristae structure

    • Determine if l-form and s-form OPA1 have differential effects on mtDNA

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.