Recombinant Human E-selectin (SELE)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Function

E-selectin belongs to the selectin family of adhesion molecules, characterized by:

  • C-type lectin domain: Binds sialylated, fucosylated ligands (e.g., sialyl-Lewis X [SLeX]).

  • Epidermal growth factor (EGF)-like domain: Maintains structural integrity.

  • Six Sushi (SCR) domains: Mediate extracellular interactions.

  • Transmembrane domain: Anchors the protein to endothelial cell membranes.

  • Cytoplasmic tail: Interacts with intracellular signaling pathways .

The protein is transiently expressed on endothelial cells in response to cytokines like TNF-α and IL-1, peaking at 6–12 hours post-stimulation .

Production and Expression Systems

Recombinant E-selectin is synthesized using diverse expression hosts, yielding varying molecular weights and functional properties.

SourceExpression HostMolecular WeightPurityTagsKey Applications
Elabscience HEK293 Cells58.6 kDa (calc.)>95%C-HisCell culture, binding assays
Sigma-Aldrich CHO Cells~104 kDa (observed)≥95%NoneCell adhesion studies
Prospec Bio E. coli45.22 kDa>95%N-HisStructural studies, ELISA
R&D Systems Mammalian Cells84–109 kDa (SDS-PAGE)>95%C-HisChemotaxis, leukocyte adhesion

Challenges:

  • E. coli-expressed E-selectin often requires refolding from inclusion bodies using arginine and cysteine/cystine buffers to restore activity .

  • Mammalian systems (CHO, HEK293) yield glycosylated proteins with native ligand-binding capacity .

Leukocyte Adhesion and Inflammation

Recombinant E-selectin mimics endothelial cell surfaces in vitro, enabling studies of:

  • Leukocyte rolling: Mediated by low-affinity interactions with SLeX-bearing ligands under shear stress .

  • Chemoresistance: AML blasts with high E-selectin binding survive chemotherapy and contribute to relapse .

StudyKey FindingCitation
AML Leukemia Model E-selectin blockade (GMI-1271) reduces chemoresistant LRCs by 4–10 fold.
Neutrophil Binding Endogenous receptors are sialylated fucosylated glycolipids (GSLs).

Cancer Metastasis

E-selectin promotes tumor cell homing by binding to cancer cell surface ligands. For example:

  • Breast cancer: Selectin-deficient mice show reduced metastatic homing to lungs .

  • Colorectal cancer: E-selectin enhances HMGB1 release, exacerbating metastasis .

Clinical Relevance and Therapeutic Targets

E-selectin’s role in niche-mediated survival of malignant cells makes it a target for adjuvant therapies:

  • Uproleselan (GMI-1271): A small-molecule E-selectin antagonist that synergizes with chemotherapy in AML .

  • ELISA Kits: Detect soluble E-selectin (sE-selectin) in serum/plasma to monitor inflammatory or oncological conditions .

Table 1: Comparative Analysis of Recombinant E-selectin Preparations

ParameterElabscience Prospec Bio R&D Systems
Expression HostHEK293E. coliMammalian
Refolding RequiredNoYesNo
Ligand BindingValidatedK<sub>d</sub> = 321 nMED<sub>50</sub> = 0.2–1 μg/mL

Table 2: E-selectin in Disease Models

DiseaseModelOutcomeCitation
AMLSele<sup>−/−</sup> mice12-fold reduction in chemoresistant LRCs
Breast CancerSelectin-deficient miceReduced lung metastasis
Colorectal CancerHMGB1 release assayE-selectin enhances pro-metastatic signaling

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SELE; ELAM1; E-selectin; CD62 antigen-like family member E; Endothelial leukocyte adhesion molecule 1; ELAM-1; Leukocyte-endothelial cell adhesion molecule 2; LECAM2; CD antigen CD62E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-610
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL
Uniprot No.

Target Background

Function
E-selectin is a cell-surface glycoprotein that plays a crucial role in immunoadhesion. It mediates the adhesion of blood neutrophils to cytokine-activated endothelium through interaction with SELPLG/PSGL1. E-selectin may also be involved in capillary morphogenesis.
Gene References Into Functions
  1. Research highlights novel mechanisms by which p38 downregulates E-selectin expression through miR-146a and miR-31 following inflammatory stimuli associated with cancer progression. PMID: 29402939
  2. Levels of E-selectin and P-selectin demonstrated a positive correlation with the length of hospital stay. PMID: 29517629
  3. Our study indicates a significant association of E-selectin gene polymorphism (Leu554Phe) with essential hypertension. PMID: 29178542
  4. The highest levels of sL- and sE-selectin were observed in colorectal cancer patients with lymph node metastasis. PMID: 27775438
  5. Circulating CD62E(+) microparticle levels are abnormal in individuals with prediabetes. PMID: 28927403
  6. sVCAM-1 reflects xerostomia in primary Sjogren's syndrome. sICAM-1 and sE-selectin may serve as additional markers of secondary Sjogren's syndrome activity. PMID: 29068581
  7. Neutrophil rolling over E-selectin at specific shear stress transmits tension and catch-bond formation with L-selectin via sLe(x), resulting in focal clusters that deliver a distinct signal to upshift beta2-integrins to a high-affinity state. Rivipansel effectively blocked the formation of selectin catch-bonds, unveiling a novel mechanotransduction circuit. PMID: 28811304
  8. E-selectin-dependent rolling promotes adhesion to HA by physically slowing cells and enabling them to position near the surface, thereby increasing the on rate of adhesion. PMID: 28765175
  9. High E-selectin expression is associated with breast cancer metastasis. PMID: 27220365
  10. This study demonstrates that two adhesion molecules, shed as soluble forms, are elevated during the acute phase of leptospirosis: E-selectin and s-ICAM1. These molecules may interfere with the process of immune cell recruitment to clear Leptospira at tissue levels. PMID: 28686648
  11. ELAM-1 upregulation may contribute to disruption in cell adhesion and migration, potentially leading to endometriosis. PMID: 27433816
  12. Elevated endothelium-related mediators (vWF, E-selectin, and EPCR) appear to participate in the development of pancreatic necrosis and may serve as a potential indicator of overall prognosis. PMID: 28007459
  13. The interplay between flow-dependent on-rate and off-rate of E-selectin-ligand bonds determines flow-enhanced cell rolling stability. PMID: 27558713
  14. High SELE expression is associated with inflamed atherosclerotic plaque. PMID: 27237221
  15. In this study, we investigated sLex expression in conjunction with two glycoproteins (BST-2 and LGALS3BP), known to interact with E-selectin in a carbohydrate-dependent manner, in a cohort of 249 invasive breast cancers. PMID: 27176937
  16. SELE expression is significantly upregulated in human masticatory mucosa during wound healing. PMID: 28005267
  17. E-selectin concentrations in this study were associated with hyperglycemia, potentially reflecting early endothelial damage. E-selectin was not found to be useful in assessing carotid intima-media thickness, a marker of subclinical atherosclerosis, which appeared to be determined by aging and male gender. PMID: 27141013
  18. Plasma E-selectin is overexpressed in pediatric patients with mycoplasma pneumoniae pneumonia and myocardial injury. PMID: 26843511
  19. The significant presence of CLA+ T cells and E-selectin (CD62E) expressions in oral lichen planus (OLPG) suggests their involvement in the etiopathogenesis of the condition; however, only a weak correlation between CLA+ T cells and E-selectin was observed. PMID: 26332489
  20. BD patients exhibit a lower expression of ICAM-1, VCAM-1, and E-selectin in their tumor tissues. BD-HDL facilitates the adhesion of tumor cells to vascular endothelium by upregulating the expression of ICAM-1 and VCAM-1, thereby promoting the initial progression of breast cancer metastasis. PMID: 26872904
  21. The E-selectin S149R polymorphism is associated with the oncogenesis of breast cancer. PMID: 26828984
  22. Neisseria meningitidis induced a high level of E-selectin expression elicited by the activity of phosphorylated ATF2 transcription factor on the E-selectin promoter. PMID: 26153406
  23. E-selectin is more effective than cTnI in diagnosing myocardial injury in children. PMID: 26617843
  24. Inhibition of E-selectin expression exhibits an anti-tumoral effect on sLex-expressing hepatocellular carcinoma tumors in vivo. PMID: 26988221
  25. Glycosphingolipids likely contribute to human myeloid cell adhesion to E-selectin under fluid shear, particularly the transition of rolling cells to firm arrest. PMID: 26868209
  26. Data indicates that both mucin16 (MUC16) and podocalyxin (PODXL)-E-selectin-mediated interactions are mechanically stronger than similar L-selectin interactions at the single-molecule level. PMID: 26329844
  27. These findings provide consistent evidence that A516C and G98T polymorphisms of the SELE gene may be associated with increased susceptibility to coronary artery disease. PMID: 26937892
  28. Glaucomatous MYOC mutations activate the IL-1beta/NF-kappaB inflammatory stress response and the glaucoma marker SELE in trabecular meshwork cells. PMID: 26396484
  29. P. gingivalis was shown to activate NOD1, NOD2, and TLR2 expression, resulting in increased E-selectin expression in endothelial cells; direct inhibition of NF-kappaB and P38 MAPK significantly attenuated E-selectin expression induced by P. gingivalis in endothelial cells. PMID: 25939768
  30. The number of E-selectin-positive cells was significantly higher in the tuberculoid form than in the lepromatous form of leprosy skin lesions. PMID: 26051909
  31. Gene-based study revealed significant associations of the SELE gene with Blood Pressure phenotypes for the first time among the Chinese Han population. PMID: 25424718
  32. This study showed that no significant differences in F206L Polymorphism of l-Selectin Between the Patients with Bronchial Asthma and Control. PMID: 24798295
  33. Blood ESEL was higher in pregnant women with preeclampsia, and non-pregnant women with a history of preeclampsia than women without preeclampsia or a history of preeclampsia. PMID: 26116870
  34. The findings suggest that C allele carriers of the SELE gene polymorphism (A561C) might be predisposed to EH in the Chinese population. PMID: 25171839
  35. E-selectin promoter was highly and specifically acetylated in the confluent monolayer after tumor necrosis factor alpha activation. PMID: 24690766
  36. E-selectin interactions with glycoprotein ligands (CD44/hematopoietic cell E-/L-selectin ligand and PSGL-1) mediate the initial capturing of cells out of flow. PMID: 26124272
  37. SELE rs3917412 and MTHFR rs1801133 SNPs could serve as pharmacogenetic predictors of tumor recurrence in patients with early-stage colon cancer treated with oxaliplatin-based adjuvant chemotherapy. PMID: 24980946
  38. sE-selectin and the LDL were the most important predictors of late arteriovenous fistula stenosis. PMID: 24627030
  39. The C allele of E-selectin A561C gene polymorphism might increase the essential hypertension (EH) risk in Asian populations, whereas the T allele of E-selectin C1839T gene polymorphism might decrease the EH risk. [meta-analysis] PMID: 25003340
  40. Bereaved respondents exhibited higher levels of inflammatory biomarkers IL-6 and sE-selectin, but not CRP and sICAM-I, compared to the non-bereaved. PMID: 24266503
  41. SE-selectin and PAPPA may contribute to future cardiovascular events in women following preeclampsia; in contrast, ApoB may be involved in a protective mechanism. PMID: 25238218
  42. The haplotype TCC in Han hypertensive patients and the haplotype GGC in Mongolian patients had independent effects in increasing the risk for essential hypertension; multiple single-nucleotide polymorphisms in combination in SELE may confer a risk of hypertension. PMID: 25748737
  43. The AC genotype was found to be a significant risk factor for hemorrhagic stroke, and we also observed significant differences in AC genotype and C allele among hemorrhagic stroke and ischemic stroke patients. PMID: 25168603
  44. The rs5361 E-selectin gene polymorphism is not a susceptibility marker for ACS in the Western Mexico population. However, sE-selectin may serve as a biological marker of ACS. PMID: 25147432
  45. ST3Gal-4 is the primary sialyltransferase regulating the synthesis of E-, P-, and L-selectin ligands on human myeloid leukocytes. PMID: 25498912
  46. An upregulation of E-selectin and the associated influx of neutrophils may play a significant role in the resolution of inflammation as well as in the pathophysiology of nasal polyps in Caucasian chronic rhinosinusitis patients. PMID: 24995349
  47. In human aortic and vein endothelial cells, expression and release of ICAM-1 and E-selectin were induced by treatment with conditioned medium collected from Pal-stimulated pTHP-1 cells. PMID: 25201247
  48. CD62E was found to be a novel biomarker for patients with hypertension and hyperlipidemia. PMID: 24820735
  49. High E-selectin expression is associated with small cell lung cancer metastasis. PMID: 24699516
  50. There was an association between the E-selectin S128R polymorphism and the risk of cancer. PMID: 24815478

Show More

Hide All

Database Links

HGNC: 10718

OMIM: 131210

KEGG: hsa:6401

STRING: 9606.ENSP00000331736

UniGene: Hs.82848

Protein Families
Selectin/LECAM family
Subcellular Location
Cell membrane; Single-pass type I membrane protein.

Q&A

What is E-selectin and what is its physiological role?

E-selectin (CD62E, also known as Endothelial Leukocyte Adhesion Molecule-1 or ELAM-1) is a 107-115 kDa cell surface glycoprotein that belongs to the selectin family of adhesion molecules. It is transiently expressed on vascular endothelial cells specifically in response to inflammatory cytokines such as IL-1β and TNF-alpha. E-selectin mediates the initial attachment of flowing leukocytes to the blood vessel wall during inflammation, allowing leukocytes to roll along the vascular endothelium in the direction of blood flow. This initial labile interaction is subsequently followed by stronger interactions involving other adhesion molecules like ICAM-1 and VCAM-1, eventually leading to leukocyte extravasation through the blood vessel wall into the extracellular matrix tissue .

E-selectin expression shows a characteristic temporal pattern, reaching peak expression at approximately 4 hours after activation and declining by 24 hours . This tightly regulated expression pattern makes E-selectin a critical early mediator in the inflammatory cascade.

How does recombinant human E-selectin compare to native E-selectin in terms of structure and function?

Recombinant human E-selectin proteins typically include the extracellular domain (from Trp22-Pro556) and often contain a C-terminal tag (such as a 6-His tag) for purification and detection purposes . When properly produced, recombinant E-selectin retains the functional properties of native E-selectin, including its ability to support leukocyte adhesion. Functional assays demonstrate that recombinant E-selectin supports the adhesion of cells like U937 human histiocytic lymphoma cells with an ED50 of 0.2-1 μg/mL .

The calcium dependency of E-selectin binding is preserved in recombinant forms, as demonstrated by control experiments showing binding inhibition when calcium is chelated by EDTA . Structurally, when analyzed by SDS-PAGE, recombinant human E-selectin His-tag proteins show bands at 84-109 kDa under reducing conditions and 60-84 kDa under non-reducing conditions, reflecting the glycosylation status and proper folding of the protein .

What are the optimal conditions for reconstitution and storage of recombinant human E-selectin?

Recombinant human E-selectin is typically supplied as a lyophilized protein from a 0.2 μm filtered solution in PBS. For optimal reconstitution, it should be reconstituted at a concentration of 500 μg/mL in PBS . To maintain protein stability:

  • Use a manual defrost freezer and avoid repeated freeze-thaw cycles

  • Store reconstituted protein at the recommended temperature (typically -20°C or -80°C)

  • If carrier-free preparations are used (without BSA), special care should be taken to prevent protein degradation

For functional assays, it's critical to include calcium in buffers (typically 2mM CaCl2), as E-selectin binding is calcium-dependent. Control experiments should include EDTA (10mM) to demonstrate specificity of binding .

What methods are available for quantitative measurement of E-selectin interactions with its ligands?

Several methodologies have been developed for measuring E-selectin interactions with its ligands:

  • Surface Plasmon Resonance (SPR): Real-time immunoprecipitation assays on SPR chips allow quantitative and rapid measurement of E-selectin interactions with its ligands following cell lysis. This technique enables measuring binding kinetics (on- and off-rates) of E-selectin with its ligands in their native post-translationally modified forms .

  • Microarray Experiments: E-selectin proteins can be analyzed using glycan microarrays (such as Consortium for Functional Glycomics version 5.2 microarrays) to evaluate binding specificity. In this approach, microarray slides are rehydrated in appropriate buffer (e.g., TSM buffer containing 20 mM Tris-HCl, 150 mM NaCl, 2 mM CaCl2, and 2 mM MgCl2), and Fc-tagged E-selectin is applied. Bound selectins are detected with fluorescently-labeled anti-human IgG antibodies and quantified using appropriate scanning and software tools .

  • Cell Adhesion Assays: Functional binding can be quantified by measuring the adhesion of E-selectin-binding cells (like U937) to immobilized recombinant E-selectin. The ED50 for this effect typically ranges from 0.2-1 μg/mL .

What are the major glycoprotein ligands for E-selectin on human and mouse cells, and how do they differ?

E-selectin binds to sialylated, fucosylated molecules on target cells, with significant species-specific differences in both identity and activity of these structures:

LigandHuman CellsMouse CellsMolecular Weight
CD44/HCELLProminent (~100 kDa)Not detected~100 kDa
PSGL-1/CLAPresentProminent~120-130 kDa
CD43PresentPresent~120-130 kDa

On human hematopoietic stem/progenitor cells (HSPCs), the CD44 glycoform called "HCELL" serves as a prominent E-selectin ligand, whereas it is not detected on mouse HSPCs. In contrast, the P-selectin glycoprotein ligand-1 (PSGL-1) glycoform called "CLA" shows more prominent E-selectin reactivity in mouse cells .

Functional studies using silencing or enforced expression approaches have demonstrated that CD44/HCELL significantly contributes to E-selectin binding in human cells. When CD44/HCELL was silenced via siRNA in human cells, E-selectin binding decreased by more than 50% under physiologic shear conditions. Conversely, enforced HCELL expression on mouse LSK cells significantly increased E-selectin adherence, resulting in more than 3-fold enhanced marrow homing in vivo .

What is the molecular basis for E-selectin recognition of its ligands, and how can this be modified experimentally?

E-selectin recognition of ligands depends on specific molecular interactions that can be manipulated through protein engineering. Computational approaches have been successfully used to engineer mutated forms of E-selectin with altered binding specificities.

A prime example is the engineering of E-selectin to recognize 6′-sulfo-sialyl Lewis X (6′-sulfo-sLex) instead of its natural ligand sialyl Lewis X (sLex). This was achieved through a double mutation (E92A/E107A) that:

  • Removed unfavorable interactions with the 6′-sulfate group

  • Introduced favorable interactions for the sulfate

  • Eliminated favorable interactions with the endogenous ligand

Molecular dynamics simulations and energy calculations predicted these mutations would stabilize binding to the sulfated oligosaccharide. Glycan microarray screening confirmed the predicted specificity change, demonstrating that the mutant E-selectin bound to 6′-sulfo-sLex with negligible binding to its endogenous nonsulfated ligand sLex .

This approach illustrates how rational design assisted by computational approaches can create proteins with novel glycan recognition patterns, potentially useful for detecting disease-associated sulfated glycans.

How can different forms of recombinant E-selectin (monomeric vs. dimeric) impact experimental results?

The oligomeric state of recombinant E-selectin significantly affects its binding kinetics to ligands. Research has shown that:

  • Monomeric E-selectin binds transiently to ligands like CD44/HCELL and PSGL-1 with fast on-rates and fast off-rates.

  • Dimeric E-selectin interacts with the same ligands with remarkably slower on-rates and off-rates .

This difference in binding kinetics has important implications for experimental design. When studying transient interactions that mimic physiological rolling adhesion, monomeric E-selectin may provide more relevant data. Conversely, dimeric E-selectin may be more suitable for applications requiring stable binding, such as detecting low-abundance ligands.

Researchers should carefully consider which form to use based on their specific experimental objectives and ensure consistent use of either monomeric or dimeric forms throughout comparative studies to avoid misinterpretation of results.

What is the role of E-selectin in angiogenesis and how can this be analyzed experimentally?

E-selectin has been implicated in angiogenesis regulation, particularly in mediating the antiangiogenic activity of endostatin (a 20-kDa fragment of collagen XVIII). Evidence suggests that E-selectin is required for endostatin's inhibitory effects on blood vessel formation .

This relationship can be analyzed using various experimental approaches:

  • In vivo corneal micropocket assays: Studies have shown that recombinant endostatin administered via osmotic pump inhibits basic fibroblast growth factor-induced angiogenesis in wild-type mice but not in E-selectin-deficient mice .

  • Ex vivo aortic ring assays: Endostatin inhibits vascular endothelial growth factor (VEGF)-stimulated endothelial sprout formation from aortic rings of wild-type mice but not from E-selectin-deficient mice .

  • In vitro cell migration assays: Human endothelial cells become more sensitive to inhibition by endostatin in VEGF-induced cell migration assays when E-selectin is induced by inflammatory stimuli like IL-1β or lipopolysaccharide .

To isolate E-selectin's role from other consequences of endothelial activation, researchers have used adenoviral E-selectin expression constructs to transduce human umbilical vein endothelial cells. These transduced cells show increased sensitivity to endostatin, and this effect requires the E-selectin cytoplasmic domain . This suggests that E-selectin may be a useful predictor and modulator of endostatin efficacy in antiangiogenic therapy.

What are the key considerations for validating E-selectin ligands on human cells where genetic manipulation is challenging?

Identifying and validating E-selectin ligands on human cells presents unique challenges because gene deletion/silencing approaches and knockout models are less feasible than in mouse systems. To address this, researchers can employ a combination of strategies:

  • Real-time immunoprecipitation on SPR chips: This powerful complementary approach allows direct measurement of E-selectin interaction with its ligands in a quantitative and rapid manner following cell lysis. Endogenous E-selectin ligands in their native post-translationally modified form are captured with high specificity from whole cell lysates via surface-immobilized monoclonal antibodies (mAbs) .

  • RNA interference approaches: Though more challenging in primary human cells, siRNA targeting of candidate ligands (like CD44) can be used to assess their functional contribution to E-selectin binding. Under physiologic shear conditions, CD44/HCELL-silenced human cells show striking decreases (>50%) in E-selectin binding .

  • Exoglycosylation: Enforcing expression of specific glycoforms through exoglycosylation provides a complementary approach to silencing. This method can be particularly useful for confirming the role of specific glycosylation patterns in E-selectin binding .

  • Blocking antibodies: Although no monoclonal antibodies against glycoproteins that block binding to E-selectin have been identified to date, developing such tools remains an important methodological goal for testing the physiologic functions of candidate E-selectin ligands on human cells .

How can researchers ensure the functional activity of recombinant E-selectin in experimental systems?

Ensuring the functional activity of recombinant E-selectin is crucial for experimental validity. Researchers should implement the following approaches:

  • Calcium dependency verification: Include control experiments with EDTA (typically 10mM) instead of calcium in binding buffer to demonstrate calcium-dependent binding, which is a hallmark of functional selectins .

  • Cell adhesion assays: Confirm that recombinant E-selectin supports the adhesion of known E-selectin-binding cells such as U937 human histiocytic lymphoma cells. The ED50 for functional E-selectin is typically 0.2-1 μg/mL .

  • SDS-PAGE analysis: Verify protein integrity through SDS-PAGE under reducing and non-reducing conditions. Functional recombinant human E-selectin typically shows bands at 84-109 kDa and 60-84 kDa, respectively .

  • Glycan array binding: Validate binding specificity using glycan arrays containing known E-selectin ligands like sLex. This approach is particularly important when working with engineered variants of E-selectin .

  • Flow-based assays: Since E-selectin mediates rolling adhesions under flow conditions in vivo, flow-chamber assays that mimic physiological shear stress provide the most relevant functional validation. These assays can distinguish between E-selectin-mediated transient interactions and more stable adhesions mediated by other molecules .

How might engineered E-selectin variants be applied in glycan biomarker detection and disease monitoring?

Engineered E-selectin variants with altered binding specificities represent promising tools for detecting disease-associated glycans. The successful creation of an E-selectin double mutant (E92A/E107A) that specifically recognizes 6′-sulfo-sLex demonstrates the feasibility of this approach .

Potential applications include:

  • Cancer biomarker detection: Altered glycosylation patterns are hallmarks of many cancers. Engineered E-selectin variants could detect specific cancer-associated glycans like sulfated glycans that are upregulated in certain malignancies.

  • Inflammatory disease monitoring: Custom E-selectin variants could detect glycan changes associated with inflammatory conditions, potentially providing more specific markers than general inflammation indicators.

  • Glycan array-based diagnostics: Libraries of engineered E-selectin proteins with different specificities could be developed for comprehensive glycan profiling of patient samples, potentially identifying disease-specific glycosylation signatures.

  • In vivo imaging: Labeled E-selectin variants with specificity for disease-associated glycans could potentially serve as targeting molecules for molecular imaging applications.

The rational design approach using computational methods to predict mutations that alter glycan recognition specificity provides a template for creating additional E-selectin variants recognizing other clinically relevant glycan structures .

What are the implications of species-specific differences in E-selectin ligands for translational research?

The significant differences between human and mouse E-selectin ligands have important implications for translational research:

  • Model selection: The prominent role of HCELL in human but not mouse cells suggests that mouse models may not fully recapitulate human E-selectin-dependent processes. Researchers should carefully consider these differences when selecting animal models and interpreting results .

  • Hematopoietic stem cell transplantation: Since HCELL significantly contributes to human HSPC binding to E-selectin and marrow homing, strategies to optimize HSPC engraftment may differ between species. Enforced HCELL expression on mouse cells increased marrow homing more than 3-fold, highlighting potential therapeutic approaches for enhancing engraftment in clinical settings .

  • Drug development: Therapeutics targeting E-selectin interactions may need to address different ligands depending on whether the target is human or mouse E-selectin. This has implications for preclinical testing and translation to clinical applications.

  • Biomarker development: Species differences suggest that biomarkers based on E-selectin ligand expression or modification may not directly translate between mice and humans.

These species-intrinsic differences underscore the need for complementary approaches using both human samples and appropriate animal models in E-selectin research, particularly when developing therapeutics targeting this pathway .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.