Recombinant Human E3 ubiquitin-protein ligase MARCH11 (MARCH11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MARCHF11; MARCH11; E3 ubiquitin-protein ligase MARCHF11; Membrane-associated RING finger protein 11; Membrane-associated RING-CH protein XI; MARCH-XI; RING-type E3 ubiquitin transferase MARCHF11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-402
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
MARCH11
Target Protein Sequence
MSFEGGHGGSRCRGAESGDAEPPPQPPPPPPPTPPPGEPAPVPAAPRYLPPLPASPETPE RAAGPSEPLGEVAPRCRGADELPPPPLPLQPAGQEVAAAGDSGEGPRRLPEAAAAKGGPG ESEAGAGGERERRGAGDQPETRSVCSSRSSSSGGGDQRAGHQHQHHQPICKICFQGAEQG ELLNPCRCDGSVRYTHQLCLLKWISERGSWTCELCCYRYHVIAIKMKQPCQWQSISITLV EKVQMIAVILGSLFLIASVTWLLWSAFSPYAVWQRKDILFQICYGMYGFMDLVCIGLIVH EGAAVYRVFKRWRAVNLHWDVLNYDKATDIEESSRGESSTSRTLWLPLTALRNRNLVHPT QLTSPRFQCGYVLLHLFNRMRPHEDLSEDNSSGEVVMRVTSV
Uniprot No.

Target Background

Function
MARCH11 is an E3 ubiquitin-protein ligase mediating the polyubiquitination of CD4. As an E3 ligase, it accepts ubiquitin from an E2 ubiquitin-conjugating enzyme via a thioester bond, subsequently transferring the ubiquitin to target substrates. MARCH11 may play a role in ubiquitin-dependent protein sorting during spermatid development.
Gene References Into Functions
  1. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
Database Links

HGNC: 33609

OMIM: 613338

KEGG: hsa:441061

STRING: 9606.ENSP00000333181

UniGene: Hs.662216

Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein.

Q&A

What is E3 ubiquitin-protein ligase MARCH11 and what are its main functions?

E3 ubiquitin-protein ligase MARCH11 (also known as Membrane-associated RING finger protein 11 or Membrane-associated RING-CH protein XI) is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). These enzymes play a crucial role in the ubiquitination pathway by accepting ubiquitin from E2 ubiquitin-conjugating enzymes in the form of a thioester and then directly transferring the ubiquitin to targeted substrate proteins . The primary function of MARCH11 is to mediate polyubiquitination of specific proteins, particularly CD4, thereby signaling their intracellular transport. Additionally, MARCH11 appears to play a significant role in ubiquitin-dependent protein sorting in developing spermatids, suggesting its importance in reproductive biology and cellular development .

MARCH11 functions through a catalytic mechanism common to E3 ubiquitin ligases, whereby it recognizes specific substrate proteins and facilitates the transfer of ubiquitin molecules to lysine residues on these substrates. This post-translational modification serves as a molecular signal that can direct proteins to various cellular fates, including degradation via the 26S proteasome, altered subcellular localization, or modified protein-protein interactions. The specificity of MARCH11 for its substrates is determined by specific recognition domains within its structure.

What is the structural organization of MARCH11 and how does it compare to other MARCH family proteins?

MARCH11 is an integral membrane protein characterized by multiple transmembrane domains and a RING-CH (Really Interesting New Gene-Cysteine/Histidine-rich) finger domain that is essential for its ubiquitin ligase activity. The protein is organized with specific domains that facilitate its localization to cytoplasmic vesicle membranes and enable its function in ubiquitin transfer .

The protein exists in two isoforms produced by alternative splicing, which may have context-dependent functions in different cellular environments or developmental stages . The RING-CH domain contains conserved cysteine and histidine residues that coordinate zinc ions, a feature critical for catalytic activity. This domain is responsible for binding to E2 ubiquitin-conjugating enzymes and facilitating the transfer of ubiquitin to substrate proteins.

When compared to other MARCH family members, MARCH11 shares the characteristic RING-CH domain but exhibits distinct substrate specificities and cellular localization patterns. These differences likely account for the non-redundant functions of individual MARCH family proteins in various cellular processes and tissues.

Where is MARCH11 primarily expressed and what cellular compartments does it localize to?

MARCH11 is primarily expressed in specific tissues, with notable expression in developing spermatids, suggesting a specialized role in spermatogenesis and reproductive biology. At the subcellular level, MARCH11 localizes to cytoplasmic vesicle membranes and is classified as an integral membrane protein . This localization is consistent with its role in protein sorting within the trans-Golgi network (TGN)-multivesicular body (MVB) transport pathway.

The specific membrane localization of MARCH11 is critical for its function, as it positions the enzyme to participate in the ubiquitination of membrane proteins that are being trafficked through various intracellular compartments. The protein contains transmembrane domains that anchor it to these membranes, with the catalytic RING-CH domain oriented to access substrate proteins and E2 enzyme partners effectively.

Research examining the spatial and temporal expression patterns of MARCH11 has revealed that its expression is developmentally regulated, further supporting its specialized roles in specific biological processes rather than functioning as a ubiquitous housekeeping enzyme.

What are the most effective methods for producing recombinant MARCH11 protein for in vitro studies?

Producing functional recombinant MARCH11 presents several challenges due to its multiple transmembrane domains and requirement for proper folding and post-translational modifications. For in vitro studies, researchers have developed several approaches with varying success rates:

Bacterial Expression Systems:
While E. coli expression systems offer simplicity and high yields, they often struggle with proper folding of complex mammalian proteins like MARCH11. For successful bacterial expression, researchers should consider:

  • Using specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Expressing truncated versions containing only the RING-CH domain for enzymatic studies

  • Employing fusion tags (MBP, SUMO) to enhance solubility

  • Optimizing growth conditions (reduced temperature, specific media formulations)

Eukaryotic Expression Systems:
For full-length, properly folded MARCH11, eukaryotic systems typically yield better results:

  • Insect cell expression using baculovirus systems (Sf9, High Five cells)

  • Mammalian cell expression (HEK293, CHO cells) for native-like post-translational modifications

  • Yeast expression systems (Pichia pastoris) as a balance between yield and proper folding

The choice of expression system should be guided by the specific research questions being addressed. For structural studies requiring large amounts of protein, bacterial or insect cell systems may be preferable despite potential folding issues. For functional assays where native conformation is critical, mammalian expression systems are often more appropriate despite lower yields.

What are the recommended approaches for studying MARCH11 substrate specificity?

Understanding the substrate specificity of MARCH11 is crucial for elucidating its biological functions. Several complementary approaches can be employed:

In Vitro Ubiquitination Assays:

  • Reconstitute the ubiquitination reaction using purified components (E1, E2, MARCH11, ubiquitin, ATP, potential substrates)

  • Monitor ubiquitin transfer using Western blotting or mass spectrometry

  • Employ ubiquitin variants (e.g., lysine mutants) to determine ubiquitin chain topology

Cellular Approaches:

  • Overexpress or knock down MARCH11 in relevant cell types and monitor changes in the ubiquitination status of potential substrates

  • Use proximity-based labeling techniques (BioID, APEX) to identify proteins in close proximity to MARCH11

  • Perform co-immunoprecipitation experiments to detect substrate interactions

Proteomics-Based Methods:

  • Quantitative proteomics comparing ubiquitinomes of control and MARCH11-manipulated samples

  • Ubiquitin remnant profiling to identify specific lysine residues modified in a MARCH11-dependent manner

  • Comparison of protein half-lives in the presence and absence of MARCH11 activity

A comprehensive understanding of MARCH11 substrate specificity typically requires integration of data from multiple approaches, as each method has inherent limitations and biases. The known interaction with CD4 can serve as a positive control in these experiments to validate the methodological approach .

How can researchers effectively analyze MARCH11 localization and trafficking in living cells?

Analyzing the localization and trafficking of MARCH11 in living cells requires specialized approaches due to its membrane association and dynamic movement between cellular compartments:

Fluorescence Microscopy Approaches:

  • Generate fluorescent protein fusions (e.g., MARCH11-GFP) ensuring the tag doesn't interfere with localization signals

  • Validate localization patterns using co-localization with established organelle markers (e.g., TGN46 for trans-Golgi, LAMP1 for lysosomes)

  • Employ super-resolution microscopy techniques (STED, PALM, STORM) for detailed subcellular localization

Live Cell Imaging:

  • Use spinning disk confocal or light sheet microscopy for rapid acquisition of trafficking events

  • Apply photoactivatable or photoconvertible fluorescent proteins to track specific pools of MARCH11

  • Implement FRAP (Fluorescence Recovery After Photobleaching) to measure mobility within membranes

Quantitative Analysis Methods:

  • Develop computational approaches for tracking vesicle movement in time-lapse series

  • Apply correlation analysis to quantify co-trafficking with known vesicular markers

  • Utilize pulse-chase approaches with photoconvertible tags to follow protein cohorts over time

When designing these experiments, researchers should be cautious about potential artifacts from overexpression, as abnormal levels of MARCH11 might alter its localization pattern or trafficking behavior. Complementary approaches using antibody detection of endogenous MARCH11 in fixed cells can help validate findings from live-cell imaging studies with fluorescent fusion proteins.

What are the critical factors to consider when designing CRISPR-Cas9 experiments targeting MARCH11?

Designing effective CRISPR-Cas9 experiments for MARCH11 modification requires careful consideration of several factors to ensure specificity, efficiency, and appropriate phenotypic analysis:

Guide RNA Design Considerations:

  • Target functional domains (RING-CH domain, substrate binding regions) for specific functional disruption

  • Use algorithms that optimize on-target efficiency while minimizing off-target effects

  • Consider targeting regions that affect specific splice variants if isoform-specific functions are being investigated

  • Design multiple guide RNAs to control for potential off-target effects

Delivery and Screening Strategies:

  • Select appropriate delivery methods based on target cell type (lipofection, electroporation, viral delivery)

  • Design efficient screening strategies to identify successfully edited cells (restriction digests, T7E1 assays, sequencing)

  • Consider implementing Cas9 nickase approaches for higher specificity in editing

Functional Validation Approaches:

  • Develop comprehensive phenotypic assays focusing on known MARCH11 functions (e.g., CD4 ubiquitination, protein sorting in relevant cell types)

  • Include rescue experiments with wild-type or mutant MARCH11 to confirm specificity of observed phenotypes

  • Analyze effects on both known and potential novel substrates

Special Considerations for MARCH11:

  • As MARCH11 appears to function in specific developmental contexts (e.g., spermatid development), ensure editing experiments are conducted in relevant cell types or model systems

  • Consider potential compensatory mechanisms by other MARCH family members when analyzing phenotypes

  • Evaluate effects on both protein levels and subcellular localization of substrates

The recombineering approaches described in search result could potentially be adapted for precise modification of MARCH11, allowing for more controlled genomic editing than traditional CRISPR-Cas9 approaches in certain experimental contexts.

How can researchers effectively investigate the role of MARCH11 in the TGN-MVB transport pathway?

Investigating MARCH11's role in the trans-Golgi network-multivesicular body (TGN-MVB) transport pathway requires specialized approaches that address both the protein's enzymatic activity and its physical participation in vesicular transport:

Cargo Trafficking Assays:

  • Track the movement of known or potential MARCH11 substrates through the TGN-MVB pathway using pulse-chase approaches

  • Implement quantitative assays to measure internalization, recycling, and degradation rates of membrane proteins

  • Compare trafficking patterns in cells with normal, depleted, or catalytically inactive MARCH11

Vesicle Isolation and Characterization:

  • Isolate TGN and MVB vesicles using differential centrifugation or immunoisolation approaches

  • Analyze protein composition of isolated vesicles using mass spectrometry

  • Examine ubiquitination patterns of vesicle-associated proteins in relation to MARCH11 activity

Functional Perturbation Experiments:

  • Express dominant-negative MARCH11 mutants (e.g., catalytically inactive variants) to disrupt normal function

  • Use acute protein depletion strategies (e.g., auxin-inducible degron systems) to observe immediate effects on transport

  • Apply specific inhibitors of vesicular transport machinery to dissect the pathway

Integrated Analysis Approaches:

  • Combine live cell imaging of cargo movement with biochemical assays of ubiquitination

  • Correlate changes in cargo ubiquitination with alterations in trafficking patterns

  • Develop mathematical models of cargo movement through the pathway based on experimental data

This multifaceted approach allows researchers to distinguish between direct effects of MARCH11-mediated ubiquitination on cargo proteins and potential structural roles of MARCH11 in organizing or stabilizing transport intermediates independent of its catalytic activity.

What methodological approaches are recommended for studying MARCH11 interactions with E2 ubiquitin-conjugating enzymes?

Understanding the interactions between MARCH11 and E2 ubiquitin-conjugating enzymes is crucial for elucidating the specificity and regulation of MARCH11-mediated ubiquitination. Several complementary approaches can be employed:

Biochemical Interaction Assays:

  • Yeast two-hybrid screens to identify potential E2 partners

  • GST pull-down assays using purified MARCH11 RING-CH domain and various E2 enzymes

  • Surface plasmon resonance or isothermal titration calorimetry to determine binding affinities

  • Co-immunoprecipitation experiments from cells expressing MARCH11 and candidate E2 enzymes

Functional Ubiquitination Assays:

  • Reconstitute ubiquitination reactions with purified components using different E2 enzymes

  • Analyze ubiquitin chain topology resulting from different MARCH11-E2 pairs

  • Compare reaction kinetics with different E2 partners to identify preferred interactions

Structural Analysis Methods:

  • X-ray crystallography or cryo-EM studies of MARCH11 RING-CH domain in complex with E2 enzymes

  • NMR spectroscopy to map interaction surfaces and conformational changes upon binding

  • Computational modeling and molecular dynamics simulations to predict interaction determinants

Cellular Validation Approaches:

  • Manipulate levels of candidate E2 enzymes in cells and assess effects on MARCH11-dependent ubiquitination

  • Use proximity ligation assays to detect E2-MARCH11 interactions in situ

  • Develop FRET-based biosensors to monitor interactions in living cells

The table below summarizes potential E2 partners for MARCH11 based on known interactions with other MARCH family members:

E2 EnzymeFamilyReported MARCH Family InteractionsPrediction for MARCH11
UBE2D1-4UBCH5 familyMARCH1, MARCH8High probability
UBE2NUBC13MARCH5, MARCH7Moderate probability
UBE2E1-3UBCH6 familyMARCH1High probability
UBE2KUBC1Not reportedLow probability
UBE2L3UBCH7MARCH7, MARCH8Moderate probability

This systematic approach allows for both discovery of novel E2-MARCH11 interactions and detailed characterization of interaction specificity and functional consequences.

What are the recommended approaches for studying MARCH11's role in spermatid development?

MARCH11's role in spermatid development requires specialized methodological approaches due to the unique characteristics of spermatogenesis and the challenges of studying protein function in this developmental context:

Model System Selection:

  • Mouse models offer the advantage of genetic manipulation and tissue accessibility

  • Cell culture systems (e.g., spermatogonial stem cell cultures, testicular organ cultures) provide controlled environments for mechanistic studies

  • When applicable, human samples can provide clinically relevant insights

Stage-Specific Analysis:

  • Implement cell sorting techniques to isolate specific spermatogenic cell populations

  • Utilize stage-specific markers to precisely identify developmental timing of MARCH11 expression

  • Apply single-cell approaches (RNA-seq, proteomics) to capture heterogeneity in developing germ cells

Functional Perturbation Strategies:

  • Generate conditional knockout models to disrupt MARCH11 specifically in developing spermatids

  • Use stage-specific promoters to drive expression of dominant-negative MARCH11 variants

  • Apply pharmacological inhibitors of the ubiquitin pathway in ex vivo testicular cultures

Phenotypic Analysis Methods:

  • Detailed morphological assessment of spermatid development using electron microscopy

  • Evaluation of protein localization patterns during spermatid differentiation

  • Functional testing of mature sperm produced in the presence or absence of MARCH11 activity

Target Identification Approaches:

  • Perform ubiquitinome analysis of isolated spermatid populations

  • Conduct proteomics comparing wild-type and MARCH11-deficient spermatids

  • Use proximity labeling approaches (BioID, APEX) in developing spermatids to identify potential substrates

This comprehensive approach enables researchers to connect MARCH11's biochemical activity to specific developmental processes in spermatid maturation, potentially revealing novel insights into the regulation of sperm development and function.

How can researchers differentiate between MARCH11-specific functions and redundant activities of other MARCH family members?

Distinguishing MARCH11-specific functions from potentially redundant activities of other MARCH family members requires careful experimental design and multiple complementary approaches:

Expression Analysis:

  • Perform comprehensive expression profiling of all MARCH family members across tissues and developmental stages

  • Identify contexts where MARCH11 is uniquely or predominantly expressed

  • Analyze subcellular localization patterns of different MARCH family members to identify unique spatial distributions

Substrate Specificity Determination:

  • Conduct comparative ubiquitination assays with multiple MARCH proteins using potential substrates

  • Perform proteome-wide analyses comparing cells expressing individual MARCH proteins

  • Identify unique structural features that might confer substrate specificity to MARCH11

Genetic Manipulation Strategies:

  • Generate single and combinatorial knockouts of MARCH family members

  • Perform rescue experiments with chimeric proteins to identify domain-specific functions

  • Use acute depletion approaches to minimize compensatory adaptations

Biochemical Distinction Methods:

  • Compare ubiquitin chain topologies generated by different MARCH proteins

  • Analyze protein-protein interaction networks specific to each MARCH family member

  • Characterize post-translational modifications that might differentially regulate MARCH family proteins

The table below outlines key distinguishing features between MARCH11 and closely related MARCH family members:

FeatureMARCH11MARCH4MARCH9MARCH10
Tissue expressionPrimarily in developing spermatidsBroad tissue distributionUbiquitous with enrichment in immune cellsTestis-specific
Subcellular localizationCytoplasmic vesicle membraneEndosomes, lysosomesEndosomes, GolgiCytoplasmic vesicles
Known substratesCD4CD4, MHC-IMHC-I, CD4, ICAM-1Unknown
E2 preferenceTo be determinedUBE2D familyUBE2D familyUnknown
Chromosomal location5p15.12q11.212q14.117q23.2

This systematic approach allows researchers to definitively attribute specific functions to MARCH11 while understanding potential functional overlap with other family members.

How can researchers overcome difficulties in detecting endogenous MARCH11 protein?

Detection of endogenous MARCH11 presents significant challenges due to its typically low expression levels, membrane localization, and potential antibody specificity issues. The following methodological approaches can help overcome these difficulties:

Antibody-Based Detection Optimization:

  • Validate multiple commercial antibodies using positive and negative controls (overexpression and knockout samples)

  • Optimize extraction conditions for membrane proteins (detergent selection, buffer composition)

  • Implement epitope retrieval techniques for immunohistochemistry applications

  • Consider using pooled antibodies targeting different epitopes to enhance signal

Signal Amplification Strategies:

  • Apply tyramide signal amplification for immunofluorescence detection

  • Use proximity ligation assays to detect MARCH11 in complex with known interacting partners

  • Implement biotin-streptavidin amplification systems for Western blotting

  • Consider mass spectrometry-based targeted proteomics as an antibody-independent approach

Enrichment Approaches:

  • Perform subcellular fractionation to concentrate membrane compartments where MARCH11 resides

  • Use immunoprecipitation with optimized conditions for membrane proteins

  • Consider expressing epitope-tagged MARCH11 from the endogenous locus (e.g., using CRISPR knock-in strategies)

Alternative Detection Methods:

  • Analyze MARCH11 mRNA as a proxy for protein expression using in situ hybridization or qRT-PCR

  • Develop activity-based probes that covalently label active MARCH11

  • Consider using substrate ubiquitination as a readout for MARCH11 activity

When troubleshooting detection issues, researchers should consider the biological context of their experiments, as MARCH11 expression is highly tissue-specific and developmental stage-dependent, with notable expression in developing spermatids .

What strategies can address challenges in assaying MARCH11 enzymatic activity?

Assaying MARCH11 enzymatic activity presents several technical challenges related to its membrane association, potential requirement for cofactors, and the complexity of the ubiquitination reaction. The following strategies can help address these challenges:

Protein Preparation Considerations:

  • Express and purify the catalytic RING-CH domain separately from transmembrane regions for soluble protein assays

  • For full-length protein, use detergent micelles or nanodiscs to maintain native conformation

  • Consider expressing MARCH11 in eukaryotic systems to ensure proper folding and post-translational modifications

  • Validate protein activity immediately after purification, as storage may affect enzymatic function

Assay Design Options:

  • Implement fluorescence-based ubiquitination assays using FRET or fluorescent ubiquitin for real-time monitoring

  • Develop reconstituted systems with purified E1, E2, MARCH11, ubiquitin, and substrate proteins

  • Use cell-based assays with substrate-reporter fusions to monitor ubiquitination in a more physiological context

  • Consider proximity-based assays that detect E2-MARCH11 interactions as a surrogate for activity

Controls and Validation:

  • Include catalytically inactive MARCH11 mutants (RING domain mutations) as negative controls

  • Use known MARCH family substrates (e.g., CD4) as positive controls for activity assays

  • Validate findings with orthogonal methods (Western blotting, mass spectrometry)

  • Implement dose-response experiments to confirm enzyme-dependent effects

Troubleshooting Considerations:

  • Systematically test different E2 enzymes to identify optimal partners for MARCH11

  • Optimize reaction conditions (pH, salt, temperature) for maximum activity

  • Consider the potential requirement for additional cofactors or membrane components

  • Test different ubiquitin variants to assess chain type preferences

By implementing these strategies, researchers can develop robust assays for MARCH11 activity that overcome the inherent challenges associated with membrane-bound E3 ligases, enabling more detailed characterization of its enzymatic properties and substrate specificity.

What emerging technologies hold promise for advancing MARCH11 research?

Several cutting-edge technologies are poised to significantly advance our understanding of MARCH11 biology and function:

Advances in Protein Structure Determination:

  • Cryo-electron microscopy for membrane protein complexes could reveal MARCH11's structure in native-like environments

  • Integrative structural biology approaches combining various techniques (X-ray crystallography, NMR, computational modeling)

  • AlphaFold and other AI-based structure prediction tools to model MARCH11 structures in the absence of experimental data

  • Single-molecule techniques to observe conformational changes during the catalytic cycle

Genome Engineering Innovations:

  • Base and prime editing technologies for precise modification of MARCH11 with minimal off-target effects

  • CRISPR interference/activation systems for temporally controlled modulation of MARCH11 expression

  • Recombineering approaches adapted from microbial systems for precise genome editing

  • Synthetic genomics approaches to create minimal systems for studying MARCH11 function

Advanced Imaging Technologies:

  • Super-resolution microscopy combined with expansion microscopy for detailed visualization of MARCH11 localization

  • Light-sheet microscopy for long-term imaging of MARCH11 dynamics in developing tissues

  • Correlative light and electron microscopy to connect MARCH11 localization with ultrastructural features

  • Imaging mass spectrometry for spatial proteomics analysis of MARCH11 and its substrates

Systems Biology Approaches:

  • Multi-omics integration combining transcriptomics, proteomics, and ubiquitinomics data

  • Network analysis to position MARCH11 within broader cellular pathways

  • Computational modeling of protein trafficking with MARCH11-dependent ubiquitination

  • Single-cell multi-omics to capture cellular heterogeneity in MARCH11 function

These emerging technologies promise to overcome current limitations in MARCH11 research, enabling more comprehensive understanding of its structure, function, and biological roles in normal development and potential disease states.

How might understanding MARCH11 contribute to therapeutic approaches for diseases involving protein trafficking defects?

The deeper understanding of MARCH11's role in protein trafficking and ubiquitin-dependent sorting could potentially inform therapeutic strategies for various diseases characterized by protein trafficking defects:

Relevance to Neurodegenerative Diseases:

  • Several neurodegenerative disorders involve defective protein trafficking and accumulation of misfolded proteins

  • Understanding MARCH11-dependent sorting mechanisms could reveal new approaches to enhance clearance of disease-associated proteins

  • Targeting E3 ligase activity has emerged as a promising therapeutic strategy, with MARCH11 potentially serving as a model for manipulating membrane protein trafficking

Reproductive Medicine Applications:

  • Given MARCH11's role in spermatid development, insights could inform treatments for specific forms of male infertility

  • Diagnostic approaches could potentially utilize MARCH11 as a biomarker for sperm development abnormalities

  • Understanding the molecular basis of sperm formation could contribute to novel contraceptive approaches

Cancer Therapy Implications:

  • Dysregulation of E3 ligases has been implicated in various cancers

  • If MARCH11 regulates key signaling receptors, it might represent a target for modulating cancer cell signaling

  • The principles of MARCH11-mediated protein sorting could inform strategies for enhancing degradation of oncogenic proteins

Drug Development Considerations:

  • Proteolysis-targeting chimeras (PROTACs) and molecular glues represent emerging approaches to harness the ubiquitin-proteasome system

  • Understanding the structural basis of MARCH11 substrate recognition could inform the design of molecules that redirect its activity

  • Small molecules that modulate MARCH11 activity or specificity could potentially be developed as research tools or therapeutic leads

While direct therapeutic applications of MARCH11 research remain speculative, the fundamental insights gained from studying its mechanisms will contribute to the broader understanding of membrane protein trafficking and quality control, with potential implications for multiple disease areas.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.