Recombinant Human E3 ubiquitin-protein ligase MARCH2 (MARCH2)-VLPs

Shipped with Ice Packs
In Stock

Product Specs

Buffer
Lyophilized from phosphate-buffered saline (PBS), 6% trehalose, pH 7.4.
Form
Lyophilized powder.
Note: The product will be shipped in lyophilized form with standard blue ice packs. Shipping in liquid form requires dry ice and necessitates prior communication; additional charges for dry ice and packaging will apply.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Delivery times are subject to variation based on purchasing method and location. Consult your local distributor for specific delivery information.
Notes
Avoid repeated freeze-thaw cycles. Upon receipt, store the protein at -20°C or -80°C to maintain activity.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C or -80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tag.
For custom tag requests, please contact us to assess feasibility.
Synonyms
MARCHF2; MARCH2; RNF172; HSPC240; E3 ubiquitin-protein ligase MARCHF2; Membrane-associated RING finger protein 2; Membrane-associated RING-CH protein II; MARCH-II; RING finger protein 172; RING-type E3 ubiquitin transferase MARCHF2
Datasheet & Coa
Please contact us to get it.
Expression Region
1-246aa
Research Area
Cell Biology
Source
Mammalian cell
Species
Homo sapiens (Human)
Target Names
MARCH2
Target Protein Sequence
MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
MARCH2 is an E3 ubiquitin-protein ligase that mediates the ubiquitination of transferrin receptor (TFRC) and CD86, promoting their endocytosis and lysosomal degradation via multivesicular bodies. As an E3 ligase, MARCH2 accepts ubiquitin from an E2 ubiquitin-conjugating enzyme, transferring it directly to target substrates. It may also play a role in endosomal trafficking through its interaction with syntaxin 6 (STX6).
Gene References Into Functions
  • Upregulation of MARCH2 expression following HIV-1 infection. MARCH2 inhibits HIV-1 production and infection through ligase activity-dependent envelope protein degradation and/or intracellular retention. PMID: 29573664
  • MARCH2 regulates autophagy by promoting CFTR ubiquitination and degradation, and impacting PIK3CA-AKT-MTOR signaling. PMID: 27308891
  • MARCH2 E3 ligase activity regulates cell surface β2-adrenergic receptor (β2AR) expression and subsequent signaling. PMID: 23166351
  • MARCH-II depletion via siRNA disrupts the trans-Golgi network (TGN) localization of syntaxin 6 and TGN38/46. PMID: 15689499
  • MARCH2 co-localizes with discs large homolog 1 (DLG1) at cell-cell contact sites. PMID: 17980554
Database Links

HGNC: 28038

OMIM: 613332

KEGG: hsa:51257

STRING: 9606.ENSP00000215555

UniGene: Hs.631861

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein.
Tissue Specificity
Broadly expressed.

Q&A

What is MARCH2 and what is its primary function in cellular processes?

MARCH2 (Membrane-Associated RING-CH-type finger 2) is an E3 ubiquitin ligase involved in intracellular vesicular trafficking. It plays a significant role in the early secretory pathway between the endoplasmic reticulum (ER) and Golgi compartments. MARCH2 directs the ubiquitination and subsequent degradation of proteins, particularly ERGIC3 (ER-Golgi intermediate compartment protein 3), which functions as a cargo receptor in both anterograde and retrograde protein trafficking . The ubiquitination activity of MARCH2 depends on its RING-CH domain, which is essential for its function as an E3 ligase. Additionally, MARCH2 has been identified as a T cell-specific restriction factor for HIV-1 infection, capable of preventing cell-to-cell transmission of the virus .

What are Virus-Like Particles (VLPs) and how do they differ from viruses?

Virus-Like Particles (VLPs) are nanostructures that mimic the structural organization of viruses but lack the viral genome, rendering them non-infectious. They possess diverse applications in therapeutics, immunization, and diagnostics. VLPs are self-assembling protein structures that display viral antigens in a highly immunogenic form, making them excellent candidates for vaccine development .

Unlike viruses, VLPs:

  • Contain no genetic material, eliminating replication capability

  • Maintain the authentic antigenic conformation of viral proteins

  • Can be produced through various expression systems

  • Are safer alternatives for immunization compared to attenuated or inactivated viruses

  • Can be engineered to display heterologous antigens for multivalent vaccine development

How can MARCH2 be expressed and purified for research applications?

For expressing and purifying recombinant MARCH2, researchers typically employ the following methodological approach:

  • Expression System Selection: Based on available data, mammalian expression systems such as HEK293 cells are preferred for MARCH2 expression, as they allow proper post-translational modifications and protein folding. This choice is supported by studies showing successful expression of related membrane proteins in mammalian systems .

  • Construct Design:

    • The full-length human MARCH2 gene (including both transmembrane domains) should be cloned into appropriate expression vectors

    • Tags such as His, FLAG, or HA can be incorporated for detection and purification

    • The canonical long isoform (March2-001) containing both transmembrane domains should be selected, as the shorter isoform (March2-002) lacking TM domains shows reduced functionality

  • Purification Protocol:

    • Cell lysis using detergent-based methods that preserve membrane protein integrity

    • Affinity chromatography utilizing the incorporated tag

    • Size exclusion chromatography for higher purity

    • Verification of protein integrity by Western blotting

  • Critical Considerations: The proper folding and maintenance of MARCH2's transmembrane domains are essential for its function, particularly for its interaction with viral envelope proteins and incorporation into VLPs .

What is the structural relationship between MARCH2's domains and its function?

MARCH2 contains several critical functional domains that determine its biological activity:

  • RING-CH Domain: This N-terminal domain is essential for the E3 ubiquitin ligase activity of MARCH2, mediating the transfer of ubiquitin to target proteins for subsequent degradation. Mutation studies have confirmed that the RING-CH domain is critical for MARCH2's antiviral function .

  • Transmembrane (TM) Domains: MARCH2 contains two transmembrane domains that are crucial for:

    • Proper subcellular localization

    • Interaction with target proteins, particularly viral envelope glycoproteins

    • Incorporation into nascent viral particles

  • Cytoplasmic Regions: These regions facilitate interactions with other cellular proteins and may contribute to substrate recognition.

DomainPositionFunctionEffect of Mutation
RING-CHN-terminalUbiquitin ligase activityLoss of antiviral function
TM Domain 1CentralMembrane anchoring, protein interactionReduced interaction with viral proteins
TM Domain 2CentralMembrane anchoring, protein interactionComplete loss of interaction with gp41, failure to incorporate into virions
Cytoplasmic RegionBetween TMsSubstrate recognitionVariable effects on function

Research has shown that alternative splicing produces at least two MARCH2 isoforms: the canonical long form (March2-001) with both TM domains, and a shorter isoform (March2-002) lacking the TM domains. Only the long isoform demonstrates antiviral activity, highlighting the importance of the TM domains for MARCH2 function .

How does MARCH2 specifically interact with viral envelope proteins to restrict viral infection?

MARCH2 interacts with viral envelope proteins through a complex mechanism that involves multiple domains and specific amino acid residues:

  • Transmembrane Domain-Mediated Interactions: Research indicates that MARCH2's transmembrane domains are crucial for its interaction with viral envelope glycoproteins. Specifically, the second TM domain is essential for MARCH2's interaction with HIV-1 gp41. When this domain is mutated or replaced, MARCH2 loses its ability to interact with gp41 and fails to incorporate into viral particles .

  • Amino Acid Specificity: Critical residues in MARCH2 determine its antiviral specificity. Studies comparing human and mouse MARCH2 revealed that position 61 (glycine in human, cysteine in mouse) is crucial for anti-HIV-1 activity. When human MARCH2 carries the amino acid of the mouse ortholog at position 61 (hMARCH2 G61C), it loses its antiviral effect against HIV-1 .

  • Mechanism of Restriction: MARCH2 appears to target viral envelope glycoproteins for ubiquitination and subsequent degradation, reducing their incorporation into nascent virions. Additionally, MARCH2 itself becomes incorporated into viral particles through its interaction with envelope proteins, potentially interfering with viral entry and infectivity .

  • Cell Type Specificity: MARCH2 acts as an HIV-1 restriction factor specifically in primary CD4+ T cells, suggesting a cell type-dependent mechanism that may involve additional cellular factors or differential expression patterns .

What are the critical steps for assembling functional MARCH2-containing VLPs?

The assembly of functional MARCH2-containing VLPs requires careful consideration of multiple factors:

  • Expression System Selection:

    • Mammalian cell lines (HEK293, Vero) offer advantages for proper protein folding and post-translational modifications of complex membrane proteins like MARCH2

    • These systems have demonstrated successful production of VLPs for various viruses including HIV-1 and influenza

  • Co-expression Strategy:

    • MARCH2 should be co-expressed with appropriate structural proteins that form the VLP scaffold

    • For HIV-1-based VLPs, co-expression with Gag protein is essential, as demonstrated in studies where HIV-1 Gag VLPs were successfully produced in mammalian cell suspension cultures

    • The ratio of MARCH2 to structural proteins must be optimized to ensure proper incorporation without disrupting VLP assembly

  • Purification Protocol:

    • Sequential centrifugation to separate cellular debris

    • Sucrose or OptiPrep gradient ultracentrifugation to isolate VLPs from exosomes and other vesicles

    • Verification of VLP formation and MARCH2 incorporation through electron microscopy and Western blotting

  • Critical Quality Attributes:

    • VLP size and morphology should be similar to the native virus

    • MARCH2 should maintain its proper orientation and functionality

    • The ubiquitin ligase activity of MARCH2 should be preserved within the VLP structure

How does MARCH2 regulate the trafficking of cargo proteins through ERGIC3 interaction?

MARCH2 plays a sophisticated role in regulating protein trafficking through its interaction with ERGIC3:

  • Ubiquitination of ERGIC3: MARCH2 directs the ubiquitination of ERGIC3 at specific lysine residues (positions 6 and 8), targeting it for subsequent degradation. This process is highly specific, as MARCH2 depletion increases endogenous ERGIC3 levels .

  • Impact on Cargo Transport: ERGIC3 functions as a cargo receptor in the early secretory pathway, with α1-antitrypsin and haptoglobin identified as likely cargo proteins. MARCH2-mediated degradation of ERGIC3 consequently reduces the trafficking and secretion of these cargo proteins .

  • Molecular Mechanisms:

    • ERGIC3 can bind to itself or to ERGIC2, forming complexes that cycle between the ER and Golgi

    • These complexes function in both anterograde and retrograde protein trafficking

    • MARCH2-mediated regulation of ERGIC3 levels provides a control mechanism for this trafficking pathway

  • Rescue of Function: Expression of ubiquitination-resistant ERGIC3 variants (with lysine-to-arginine substitutions at residues 6 and 8) largely restores the secretion of cargo proteins, confirming that MARCH2-mediated ERGIC3 ubiquitination is the primary cause of decreased trafficking .

This regulatory mechanism represents a novel control point in the early secretory pathway, with MARCH2 acting as a key modulator of protein transport through its effect on ERGIC3 stability and function.

What are the differences in MARCH2 function between species and how does this impact research using animal models?

Species-specific differences in MARCH2 function present important considerations for research using animal models:

  • Critical Amino Acid Variations:

    • Comparative studies between human and mouse MARCH2 have identified four key amino acid positions that differ: 18 (G/S), 58 (P/Q), 61 (G/C), and 75 (C/N)

    • Position 61 is particularly critical, as the G61C mutation in human MARCH2 eliminates its anti-HIV-1 activity

  • Differential Antiviral Activity:

    • Human MARCH2 demonstrates strong restriction activity against HIV-1

    • Mouse MARCH2 lacks this specific anti-HIV-1 activity but retains activity against other retroviruses like MLV

    • These differences are primarily determined by species-specific amino acid variations that affect MARCH2's interaction with viral envelope proteins

  • Implications for Animal Models:

    • Mouse models may not accurately reflect the MARCH2-mediated restriction of HIV-1 seen in humans

    • Humanized mouse models expressing human MARCH2 might be necessary for studying HIV-1 restriction

    • Alternatively, creating mouse MARCH2 variants with human-specific residues could enhance the translational value of mouse models

  • Experimental Considerations:

    • Researchers should carefully select appropriate animal models based on the specific aspects of MARCH2 function being studied

    • The use of species-specific MARCH2 variants in experimental systems can help clarify the functional conservation and divergence across species

    • Cross-species complementation experiments can identify critical functional domains

What are the most effective expression systems for producing MARCH2-VLPs for research?

The selection of an appropriate expression system is crucial for successful MARCH2-VLP production:

  • Mammalian Cell Systems:

    • Advantages: Proper protein folding, post-translational modifications, and membrane protein integration

    • Cell Lines: HEK293, Vero, CHO-K1, and BHK21 have demonstrated successful VLP production

    • Applications: These systems are particularly suitable for MARCH2-VLPs due to MARCH2's complex transmembrane topology and requirement for proper folding

    • Evidence: Studies have shown successful production of influenza and HIV-1 VLPs in mammalian cells, with particles closely resembling the original viruses in structure, size, and glycosylation patterns

  • Bacterial Systems:

    • Advantages: High yield, cost-effectiveness, scalability

    • Limitations: May not provide proper folding or post-translational modifications for complex proteins like MARCH2

    • Applications: Better suited for producing simple, non-glycosylated VLPs

    • Evidence: E. coli has been used to express viral proteins that self-assemble into VLPs, including porcine circovirus CP and parvovirus VP2

  • Insect Cell Systems:

    • Advantages: Higher eukaryotic protein processing capabilities, high expression levels

    • Applications: Suitable for MARCH2-VLPs requiring complex folding but not mammalian-specific glycosylation

    • Limitations: Glycosylation patterns differ from mammalian cells

  • Comparative Efficiency:

Expression SystemProtein FoldingPost-translational ModificationsScalabilityCostSuitability for MARCH2-VLPs
Mammalian CellsExcellentExcellentModerateHighHigh
Bacterial SystemsPoorMinimalExcellentLowLow
Insect CellsGoodGoodGoodModerateModerate
YeastGoodModerateGoodModerateModerate

For MARCH2-VLPs specifically, mammalian cell systems are recommended due to the complex nature of MARCH2 as a transmembrane protein requiring proper folding and post-translational modifications for functionality .

How can researchers effectively measure MARCH2 ubiquitination activity in the context of VLPs?

Measuring MARCH2 ubiquitination activity in VLPs requires specialized techniques:

  • In Vitro Ubiquitination Assays:

    • Components: Purified MARCH2-VLPs, E1 activating enzyme, E2 conjugating enzyme, ubiquitin (wild-type or tagged), ATP, potential substrate proteins

    • Detection: Western blotting for ubiquitinated substrates using anti-ubiquitin antibodies or antibodies against the substrate

    • Controls: Include reactions without ATP or with catalytically inactive MARCH2 mutants

  • Cellular Ubiquitination Analysis:

    • Approach: Express MARCH2 along with HA-tagged ubiquitin and potential substrates (e.g., ERGIC3) in cells producing VLPs

    • Immunoprecipitation: Pull down substrates and detect ubiquitination

    • Evidence: This approach has been successfully used to demonstrate MARCH2-mediated ubiquitination of ERGIC3 at lysine residues 6 and 8

  • VLP-Specific Ubiquitination Analysis:

    • Method: Purify VLPs and analyze the ubiquitination state of incorporated proteins

    • Technique: Immunoblotting of purified VLPs with anti-ubiquitin antibodies

    • Quantification: Densitometric analysis to compare ubiquitination levels between wild-type and mutant MARCH2-VLPs

  • MS-Based Identification of Ubiquitination Sites:

    • Approach: Tryptic digestion of purified VLPs followed by mass spectrometry

    • Analysis: Identification of peptides with the characteristic Gly-Gly remnant on lysine residues

    • Advantage: Can identify novel ubiquitination targets and specific modification sites

What are the optimal methods for assessing MARCH2-VLP incorporation into target cells?

Assessing MARCH2-VLP incorporation into target cells requires a multi-faceted approach:

  • Fluorescence-Based Tracking:

    • Method: Generate MARCH2-GFP fusion constructs for incorporation into VLPs

    • Analysis: Confocal microscopy to visualize VLP entry and trafficking within target cells

    • Quantification: Flow cytometry to measure the percentage of cells containing fluorescent VLPs

    • Validation: Co-localization studies with markers of different cellular compartments (early endosomes, late endosomes, lysosomes)

  • Biochemical Fractionation:

    • Approach: Treat cells with MARCH2-VLPs, then perform subcellular fractionation

    • Detection: Western blotting of different fractions to track MARCH2 and VLP components

    • Analysis: Determine the kinetics of VLP processing through different cellular compartments

  • Electron Microscopy Techniques:

    • Method: Immunogold labeling of MARCH2 in VLP-treated cells

    • Analysis: Transmission electron microscopy to visualize VLP location within cellular compartments

    • Advantage: Provides high-resolution images of VLP structure during cell entry

  • Functional Assays:

    • Approach: Measure the functional consequences of MARCH2-VLP uptake

    • Examples:

      • Assessment of ubiquitination patterns in target cells

      • Changes in the levels of known MARCH2 substrates like ERGIC3

      • Alterations in trafficking of cargo proteins such as α1-antitrypsin and haptoglobin

  • Protocol Optimization Considerations:

    • Cell type selection (primary T cells show differential responses to MARCH2 compared to cell lines)

    • Timing of analyses to capture the full uptake and processing kinetics

    • Controls to distinguish specific from non-specific uptake mechanisms

How can MARCH2-VLPs be utilized to study viral restriction mechanisms in different cell types?

MARCH2-VLPs offer unique opportunities for investigating viral restriction mechanisms:

  • Cell Type-Specific Restriction Studies:

    • Approach: Treat different cell types (primary CD4+ T cells, macrophages, dendritic cells) with MARCH2-VLPs followed by viral challenge

    • Analysis: Compare viral replication in MARCH2-VLP-treated versus untreated cells

    • Rationale: MARCH2 has been shown to act as a viral restriction factor specifically in primary CD4+ T cells, suggesting cell type-dependent mechanisms

  • Domain-Function Analysis:

    • Method: Generate VLPs incorporating MARCH2 variants with mutations in specific domains

    • Applications:

      • Determine which domains are essential for restriction in different cell types

      • Investigate whether the G61 residue, critical for HIV-1 restriction, functions similarly across cell types

  • Restriction Mechanism Elucidation:

    • Approach: Analyze changes in cellular protein ubiquitination patterns following MARCH2-VLP treatment

    • Techniques: Proteomics analysis to identify novel MARCH2 substrates involved in viral restriction

    • Benefits: May reveal previously unknown restriction pathways

  • Experimental Design Framework:

Research QuestionMARCH2-VLP TypeCell TypesReadoutsControls
Cell-type specificity of restrictionWild-type MARCH2-VLPsPrimary CD4+ T cells, Macrophages, Dendritic cellsViral replication, Envelope protein levelsVLPs without MARCH2
Domain requirementsVLPs with MARCH2 domain mutantsPrimary CD4+ T cellsViral incorporation, InfectivityWild-type MARCH2-VLPs
Species specificityHuman vs. Mouse MARCH2-VLPsHuman and mouse cellsRestriction activity against different virusesNo VLP treatment
Restriction mechanismWild-type MARCH2-VLPsPrimary CD4+ T cellsUbiquitinome analysis, Protein traffickingCatalytically inactive MARCH2-VLPs

What potential therapeutic applications exist for MARCH2-VLPs in antiviral strategies?

MARCH2-VLPs hold significant promise for therapeutic antiviral applications:

  • Targeted Delivery of Antiviral Factors:

    • Concept: MARCH2-VLPs can be engineered to deliver MARCH2 and other restriction factors to specific cell types

    • Advantage: The natural incorporation of MARCH2 into VLPs through interaction with viral envelope proteins provides a mechanism for targeted delivery

    • Potential: Could enhance intracellular antiviral responses in susceptible cell populations

  • Immunotherapeutic Approaches:

    • Strategy: MARCH2-VLPs can be designed to simultaneously present viral antigens and deliver MARCH2

    • Benefit: This dual-function approach could both stimulate adaptive immunity and enhance innate restriction

    • Evidence: VLPs have demonstrated high immunogenicity, capable of inducing both cellular and humoral immunity

  • Combinatorial Restriction Factor Delivery:

    • Approach: Co-incorporate MARCH2 with other restriction factors (APOBEC3G, TRIM5α, Tetherin) into VLPs

    • Rationale: Multi-factor approach could target different stages of the viral life cycle simultaneously

    • Challenge: Ensuring proper folding and function of multiple proteins within a single VLP

  • Potential Clinical Applications:

    • Pre-exposure prophylaxis: Administration of MARCH2-VLPs could potentially provide temporary enhancement of cellular restriction mechanisms

    • Adjuvant therapy: MARCH2-VLPs could complement conventional antiretroviral therapy by targeting viral proteins through a distinct mechanism

    • Reservoir targeting: MARCH2-VLPs could potentially target latent viral reservoirs through cell-specific delivery

  • Development Challenges:

    • Ensuring stability and proper function of MARCH2 in VLP formulations

    • Developing effective delivery methods to target relevant cell populations

    • Addressing potential immunogenicity of the MARCH2 protein itself

    • Optimizing production systems for clinical-grade MARCH2-VLPs

How can MARCH2-VLPs be engineered to study and manipulate intracellular protein trafficking pathways?

MARCH2-VLPs offer innovative tools for studying and manipulating protein trafficking pathways:

  • Cargo Receptor Regulation Studies:

    • Approach: Deliver wild-type or mutant MARCH2 via VLPs to modulate ERGIC3 levels

    • Application: Investigate the consequences of altered ERGIC3 levels on trafficking of specific cargo proteins

    • Evidence: MARCH2 regulates ERGIC3 through ubiquitination, affecting the trafficking of α1-antitrypsin and haptoglobin

  • Protein Secretion Pathway Analysis:

    • Method: Use MARCH2-VLPs to temporarily disrupt normal trafficking patterns

    • Readouts:

      • Changes in secretion of reporter proteins

      • Alterations in localization of secretory pathway components

      • Modifications to ER-Golgi intermediate compartment structure and function

    • Benefit: Allows temporal control of MARCH2 activity, enabling pulse-chase studies of trafficking dynamics

  • Domain-Specific Trafficking Manipulation:

    • Strategy: Engineer chimeric MARCH2 proteins with domains from other MARCH family members

    • Application: Create trafficking modulators with altered substrate specificity

    • Example: Replacing the second TM domain of MARCH2 with that from MARCH4 affected protein expression, while replacement with the transferrin receptor TM maintained membrane localization but altered function

  • Experimental Approaches:

Research ObjectiveMARCH2-VLP DesignCellular ReadoutsAnalytical Methods
ERGIC3 regulation dynamicsWild-type vs. catalytically inactive MARCH2ERGIC3 levels, cargo protein secretionWestern blot, ELISA, live-cell imaging
Substrate specificity mappingDomain-swapped MARCH2 variantsChanges in ubiquitination targetsProteomics, immunoprecipitation
Trafficking pathway visualizationFluorescently-tagged MARCH2Co-localization with pathway markersConfocal microscopy, FRET analysis
Reversible trafficking modulationInducible or photoswitchable MARCH2Temporal changes in cargo movementPulse-chase experiments, live imaging

What are the current technical limitations in MARCH2-VLP research and how might they be overcome?

Current technical limitations in MARCH2-VLP research present several challenges:

  • Production and Purification Challenges:

    • Limitation: MARCH2 is a membrane protein with complex topology, making high-yield production difficult

    • Current Approaches: Mammalian cell expression systems provide proper folding but with limited yield

    • Future Solutions:

      • Development of specialized mammalian cell lines with enhanced membrane protein expression capabilities

      • Optimization of detergent solubilization protocols for improved recovery

      • Exploration of cell-free expression systems for membrane protein production

  • Functional Assessment Limitations:

    • Challenge: Distinguishing MARCH2-specific effects from other VLP components

    • Current Methods: Comparison with control VLPs lacking MARCH2

    • Improved Approaches:

      • Development of switchable MARCH2 variants with inducible activity

      • Integration of bioorthogonal chemistry for selective activation of MARCH2 function

      • Single-particle analysis techniques to correlate structure with function

  • Cellular Delivery Obstacles:

    • Issue: Ensuring efficient delivery of functional MARCH2-VLPs to target cells

    • Current Status: Variable uptake efficiency across different cell types

    • Advanced Strategies:

      • Integration of cell-targeting ligands to enhance specificity

      • Surface modification of VLPs to improve cellular uptake

      • Development of hybrid delivery systems combining VLPs with other delivery technologies

  • Analytical Constraints:

    • Limitation: Difficulty in tracking MARCH2 activity once delivered to cells

    • Conventional Methods: Indirect assessment through substrate changes

    • Emerging Solutions:

      • Development of activity-based probes for MARCH2

      • FRET-based sensors for real-time monitoring of ubiquitination

      • Advanced proteomics workflows for comprehensive ubiquitinome analysis

  • Technical Roadmap for Advancement:

Challenge AreaCurrent LimitationsShort-term SolutionsLong-term Innovations
ProductionLow yield, complex purificationOptimized detergents, mammalian expressionEngineered cell lines, cell-free systems
FunctionalityVariable activity, short half-lifeStabilizing mutations, improved storageSwitchable variants, structure-guided engineering
DeliveryNon-specific uptake, endosomal entrapmentSurface modifications, fusion with CPPsCell-specific targeting, bioresponsive release
AnalysisIndirect readouts, low sensitivityImproved antibodies, enrichment methodsActivity sensors, single-molecule imaging

What are the most promising future research directions for MARCH2-VLPs?

Based on current knowledge and technological capabilities, several promising research directions emerge:

  • Structural Biology Approaches:

    • Cryo-electron microscopy studies of MARCH2-incorporated VLPs to understand protein arrangement

    • Structural analysis of MARCH2 in complex with viral envelope proteins to elucidate restriction mechanisms

    • Investigation of how MARCH2 conformation changes upon substrate binding and during ubiquitin transfer

  • Systems Biology Integration:

    • Comprehensive analysis of the MARCH2-regulated ubiquitinome in different cell types

    • Network-level understanding of how MARCH2 influences multiple trafficking pathways

    • Integration of proteomics, transcriptomics, and functional assays to build predictive models of MARCH2 activity

  • Therapeutic Development:

    • Engineering of enhanced MARCH2 variants with broader antiviral activity

    • Development of cell-type specific MARCH2-VLP delivery systems

    • Combination approaches integrating MARCH2-VLPs with other antiviral strategies

  • Translational Research Applications:

    • Development of MARCH2-VLPs as adjuvants for conventional vaccines

    • Exploration of MARCH2-VLPs as diagnostic tools for detecting viral proteins

    • Investigation of MARCH2's potential role in non-viral diseases involving protein trafficking dysregulation

These directions build upon the established knowledge that MARCH2 functions as a T cell-specific restriction factor for HIV-1 , regulates ERGIC3 and consequently affects protein trafficking , and can be incorporated into viral particles through TM-mediated interactions with envelope proteins .

How might emerging technologies enhance our understanding of MARCH2-VLP biology?

Emerging technologies offer transformative potential for advancing MARCH2-VLP research:

  • CRISPR-Based Approaches:

    • Application: Precise genome editing to create cell lines with tagged endogenous MARCH2

    • Benefit: Study MARCH2 function in its native context and expression level

    • Future Direction: CRISPR activation/repression systems to modulate MARCH2 expression with temporal precision

  • Advanced Imaging Technologies:

    • Methods: Super-resolution microscopy, correlative light-electron microscopy

    • Application: Visualize MARCH2-VLP interactions with cellular structures at nanoscale resolution

    • Potential: Track individual VLPs during cell entry and trafficking in real-time

  • Artificial Intelligence and Machine Learning:

    • Approach: Deep learning algorithms to predict MARCH2 substrate specificity

    • Implementation: Analysis of large-scale ubiquitination datasets to identify patterns

    • Outcome: Improved prediction of potential MARCH2 targets and regulatory networks

  • Organoid and Tissue Engineering:

    • Method: Test MARCH2-VLP function in physiologically relevant 3D tissue models

    • Advantage: Bridge the gap between cell culture and in vivo studies

    • Application: Study cell-type specific effects in complex tissue environments

  • Single-Cell Analysis:

    • Technique: Single-cell proteomics and transcriptomics following MARCH2-VLP treatment

    • Benefit: Reveal cell-to-cell variability in response to MARCH2

    • Insight: May explain why MARCH2 functions as a restriction factor specifically in CD4+ T cells

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.