Recombinant Human E3 ubiquitin-protein ligase MARCH3 (41336)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MARCHF3; MARCH3; RNF173; E3 ubiquitin-protein ligase MARCHF3; Membrane-associated RING finger protein 3; Membrane-associated RING-CH protein III; MARCH-III; RING finger protein 173; RING-type E3 ubiquitin transferase MARCHF3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MARCH3
Target Protein Sequence
MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLA TQSPFNDRPMCRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRF AVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRL EAVGLIALTVALFTIYLFWTLVSFRYHCRLYNEWRRTNQRVILLIPKSVNVPSNQPSLLG LHSVKRNSKETVV
Uniprot No.

Target Background

Function
Recombinant Human E3 ubiquitin-protein ligase MARCH3 (41336) is an E3 ubiquitin-protein ligase potentially involved in endosomal trafficking. E3 ubiquitin ligases receive ubiquitin from an E2 ubiquitin-conjugating enzyme via a thioester bond and subsequently transfer the ubiquitin to target substrates.
Gene References Into Functions
  1. MARCH3 silencing protects the endothelial barrier and upregulates OCLN, strengthening cell-cell contacts and inactivating FoxO1. PMID: 27616439
  2. LPS activation of TLR4 significantly increases MARCH3 expression; siRNA against MARCH3 prevents the LPS-induced decrease in FcgammaRIIb. PMID: 26694610
Database Links

HGNC: 28728

OMIM: 613333

KEGG: hsa:115123

STRING: 9606.ENSP00000309141

UniGene: Hs.132441

Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein.

Q&A

What is the primary biological function of MARCH3 in inflammatory pathways?

Recombinant Human E3 ubiquitin-protein ligase MARCH3 functions as a negative regulator of the IL-6-STAT3 signaling axis, which is critically involved in inflammation-associated carcinogenesis. MARCH3 specifically targets the IL-6 receptor α-chain (IL-6Rα) and its coreceptor glycoprotein 130 (gp130) for polyubiquitination, leading to their translocation to and degradation in lysosomes. This regulatory mechanism effectively suppresses downstream activation of STAT3 and the induction of STAT3-dependent target genes, thereby modulating inflammatory responses .

To investigate this function experimentally, researchers should design cellular assays that measure STAT3 phosphorylation at Y705 following IL-6 stimulation in the presence and absence of MARCH3. Additionally, monitoring the expression levels of STAT3 target genes through quantitative PCR can provide further confirmation of MARCH3's regulatory role in this pathway .

How does the structural composition of MARCH3 relate to its catalytic activity?

MARCH3 belongs to the membrane-associated RING-CH-type finger (MARCH) family of E3 ubiquitin ligases. Its catalytic activity depends critically on the integrity of its RING domain, particularly the conserved cysteine residues that coordinate zinc ions essential for E3 ligase function. Experimental evidence shows that point mutations at positions C71S, C74S, and C87S render MARCH3 catalytically inactive, demonstrating the essential role these residues play in mediating ubiquitination .

For researchers studying MARCH3 function, site-directed mutagenesis of these key cysteine residues serves as an excellent negative control in ubiquitination assays. When designing experiments to assess MARCH3 activity, always include these catalytically inactive mutants alongside wild-type protein to distinguish between specific enzymatic activity and non-specific effects .

What experimental systems are most suitable for studying MARCH3 function?

When designing experiments to study MARCH3, researchers should consider both cellular and biochemical approaches:

Experimental SystemAdvantagesLimitationsBest Applications
Human cell lines (e.g., HeLa, TF-1)Physiological context for receptor interactionsVariable endogenous expression levelsSignaling pathway analysis, localization studies
Knockout/knockdown modelsReveals endogenous functionPotential compensatory mechanismsLoss-of-function studies
Overexpression systemsClear visualization of effectsPotential artifacts from non-physiological levelsBiochemical mechanism studies
In vitro ubiquitination assaysDirect assessment of enzyme activityLacks cellular contextSubstrate specificity determination

The choice of experimental system should be guided by the specific research question. For signaling studies, cell lines that respond to IL-6 are particularly valuable. For mechanistic investigations of MARCH3's E3 ligase activity, purified protein systems may be more appropriate .

How can I determine the specific ubiquitination sites on IL-6Rα and gp130 targeted by MARCH3?

Identifying specific ubiquitination sites requires a systematic approach combining mutagenesis and biochemical analysis:

  • Generate lysine-to-arginine mutations for each lysine residue in the cytoplasmic domains of IL-6Rα and gp130. The cytoplasmic domain of IL-6Rα contains 5 lysine residues (within amino acids 387-468), while gp130 contains 16 lysine residues (within amino acids 642-918).

  • Express these mutants individually in cells with recombinant MARCH3 and assess protein levels through Western blotting. Resistance to MARCH3-mediated degradation indicates a potential ubiquitination site.

  • Confirm direct ubiquitination through immunoprecipitation of the receptor followed by immunoblotting for ubiquitin (using linkage-specific antibodies).

  • Verify findings with mass spectrometry analysis of purified receptors to detect ubiquitin remnants (GG) on specific lysine residues.

Research has identified K401 on IL-6Rα and K849 on gp130 as key ubiquitination sites targeted by MARCH3. These modifications promote K48- and K63-linked polyubiquitination of IL-6Rα and K48-linked polyubiquitination of gp130, directing these proteins toward lysosomal degradation .

What are the appropriate controls for assessing MARCH3-mediated ubiquitination in experimental settings?

When designing ubiquitination experiments involving MARCH3, implement these essential controls:

Control TypeSpecific ExamplePurpose
Negative enzyme controlMARCH3 RING domain mutants (C71S, C74S, C87S)Confirms ubiquitination is dependent on MARCH3 catalytic activity
Substrate specificity controlNon-target membrane proteinsEnsures specificity of the ubiquitination reaction
Ubiquitin linkage controlLinkage-specific ubiquitin mutants (K48R, K63R)Determines the type of polyubiquitin chains formed
Stimulus control±IL-6 stimulationConfirms stimulus-dependent regulation
Inhibitor controlProteasome inhibitors (MG132) vs. lysosomal inhibitors (Bafilomycin A1)Distinguishes between degradation pathways

How can I distinguish between direct and indirect effects of MARCH3 on inflammatory signaling pathways?

Distinguishing direct from indirect effects requires a multi-faceted experimental approach:

  • Temporal analysis: Monitor the kinetics of MARCH3-substrate interactions, ubiquitination, and downstream signaling events. Direct effects typically occur more rapidly than indirect effects.

  • Proximity-based assays: Employ techniques such as proximity ligation assay (PLA) or co-immunoprecipitation to demonstrate physical association between MARCH3 and its proposed substrates (IL-6Rα and gp130).

  • In vitro reconstitution: Establish a purified protein system with recombinant MARCH3, E1, E2, ubiquitin, and the substrate. Successful ubiquitination in this minimal system strongly suggests a direct effect.

  • Domain mapping: Identify the specific domains of MARCH3 that interact with substrates through deletion and point mutation analysis.

  • Substrate specificity: Test multiple potential substrates to determine whether MARCH3 exhibits selectivity consistent with direct targeting.

Research indicates that MARCH3 associates directly with IL-6Rα and gp130, mediating their ubiquitination following IL-6 stimulation. This evidence supports a direct effect model for MARCH3 in regulating inflammatory signaling .

What single-subject experimental designs are most appropriate for evaluating MARCH3 effects on inflammatory responses?

When designing experiments to evaluate MARCH3's effects on inflammatory responses, consider these single-subject experimental design approaches:

  • Multiple baseline design: This approach is particularly valuable when studying MARCH3's effect on multiple inflammatory markers or in different cell types. By staggering the introduction of MARCH3 manipulation (overexpression or knockdown) across different experimental units while continuously measuring inflammatory markers, researchers can establish causality while controlling for time-related confounds.

  • Withdrawal design (A-B-A): Implement MARCH3 modulation temporarily and then remove it. For example, use an inducible expression system to turn MARCH3 expression on and off while continuously monitoring inflammatory markers. This allows each experimental unit to serve as its own control.

  • Alternating treatments design: Compare multiple treatments (e.g., wild-type MARCH3, catalytically inactive mutants, and control) within the same experimental period to directly assess their differential effects on inflammatory responses.

When analyzing data from these designs, look for changes in level, trend, or variability in the dependent variable (e.g., STAT3 phosphorylation, target gene expression) that coincide with changes in the independent variable (MARCH3 manipulation). Effective experimental designs should include at least 5 data points per phase to meet quality standards for single-subject research .

How can I design experiments to resolve conflicting data about MARCH3's role in inflammatory signaling?

When confronted with conflicting data regarding MARCH3's role in inflammatory signaling:

When analyzing conflicting data, look for patterns where the level or trend of the dependent variable changes consistently with manipulation of MARCH3, even if absolute values differ between experimental systems .

What methodological approaches can determine if MARCH3's effects are tissue-specific or universal?

To determine whether MARCH3's regulatory effects are tissue-specific or universal:

Methodological ApproachImplementation StrategyData Analysis Considerations
Multi-tissue expression profilingQuantify MARCH3 expression across diverse tissues and cell types using qPCR, Western blot, and immunohistochemistryLook for correlation between expression levels and tissue-specific inflammatory phenotypes
Tissue-specific conditional knockoutsGenerate conditional MARCH3 knockout models with tissue-specific Cre recombinase expressionCompare inflammatory responses between tissue-specific knockouts and controls following inflammatory challenges
Ex vivo tissue culture experimentsIsolate diverse primary tissues/cells and manipulate MARCH3 expression ex vivoAssess consistency of responses to MARCH3 manipulation across tissue types
Tissue-specific reconstitutionRescue tissue-specific MARCH3 knockouts with wild-type or mutant MARCH3Determine if tissue-specific phenotypes can be rescued by MARCH3 reconstitution
Single-cell analysisPerform single-cell RNA-seq on tissues with heterogeneous cell populationsIdentify cell type-specific patterns of MARCH3 expression and correlation with inflammatory pathway components

When evaluating tissue specificity, implement rigorous single-subject experimental designs with adequate baseline measurements in each tissue type. Look for divergent patterns in the data that indicate tissue-specific effects, such as changes in level or trend that appear in some tissues but not others following MARCH3 manipulation .

How should I analyze data from ubiquitination assays to quantify MARCH3 activity?

Quantitative analysis of ubiquitination assays requires systematic approaches:

  • Densitometric analysis: For Western blot data of ubiquitinated proteins, use densitometry to quantify the intensity of ubiquitin signal, normalizing to total substrate protein. Express results as a ratio of ubiquitinated protein to total protein.

  • Linkage-specific analysis: When examining polyubiquitin chain types, quantify K48-linked and K63-linked ubiquitination separately, as these have distinct functional consequences. MARCH3 promotes both K48- and K63-linked polyubiquitination of IL-6Rα but primarily K48-linked polyubiquitination of gp130 .

  • Kinetic analysis: Plot ubiquitination over time following stimulation (e.g., with IL-6). Calculate the rate of ubiquitination by determining the slope of the linear portion of this curve.

  • Statistical comparison: Apply appropriate statistical tests (paired t-tests for before/after comparisons or ANOVA for multiple conditions) to determine significance. Include wild-type MARCH3, catalytically inactive mutants, and control conditions in all analyses.

When interpreting results, focus on changes in both the intensity and pattern of ubiquitination, as these can indicate different regulatory mechanisms. Changes in ubiquitination should correlate with changes in protein degradation and downstream signaling to establish functional significance .

What statistical approaches are most appropriate for analyzing changes in inflammatory marker expression in MARCH3 studies?

When analyzing inflammatory marker expression data from MARCH3 studies:

  • For parametric data with normal distribution:

    • Paired t-tests for comparing two conditions within the same sample

    • Repeated measures ANOVA for time-course experiments

    • Two-way ANOVA for examining interaction effects between MARCH3 manipulation and inflammatory stimuli

  • For non-parametric or non-normally distributed data:

    • Wilcoxon signed-rank test as an alternative to paired t-tests

    • Friedman test for repeated measures

    • Permutation-based tests for complex experimental designs

  • For single-subject experimental designs:

    • Visual analysis of level, trend, and variability changes between phases

    • Calculate effect sizes using non-overlap of all pairs (NAP) or Tau-U

    • Randomization tests to determine statistical significance

  • For multiple endpoint analysis:

    • Apply false discovery rate correction (e.g., Benjamini-Hochberg procedure) when analyzing multiple inflammatory markers

    • Consider multivariate analysis approaches like MANOVA when examining multiple related outcomes

For all statistical analyses, establish clear baseline measurements with at least 5 data points per phase. When evaluating experimental effects, look for consistent changes in level, trend, or variability that coincide with MARCH3 manipulation .

How can I integrate biochemical and cellular data to build a comprehensive model of MARCH3 function?

Integrating diverse experimental data to build a comprehensive model of MARCH3 function requires a systematic approach:

  • Data triangulation: Cross-validate findings from complementary approaches (e.g., biochemical assays, cell-based experiments, and genetic models). Look for convergent evidence that supports a consistent model of MARCH3 function.

  • Temporal integration: Align data from different time scales (seconds to days) to build a temporal map of MARCH3 activity, from initial receptor binding to downstream transcriptional changes.

  • Multi-level modeling: Integrate molecular-level data (ubiquitination, protein-protein interactions) with cellular-level outcomes (signaling pathway activation, gene expression) and physiological endpoints (inflammatory responses).

  • Network analysis: Position MARCH3 within larger signaling networks by identifying its connections to other regulatory proteins and pathways.

  • Mathematical modeling: Develop quantitative models that incorporate reaction rates, protein concentrations, and feedback mechanisms to predict system behavior under different conditions.

A comprehensive model of MARCH3 function should explain:

  • How MARCH3 recognizes its substrates (IL-6Rα and gp130)

  • The kinetics and specificity of ubiquitination (K48/K63 linkages)

  • The fate of ubiquitinated receptors (lysosomal degradation)

  • The consequences for downstream signaling (STAT3 activation)

  • The broader impact on cellular functions and inflammatory responses

This integrated model can then guide hypothesis generation for further experiments to refine understanding of MARCH3's regulatory roles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.