Recombinant Human E3 ubiquitin-protein ligase MARCH4 (41337)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Recombinant Human E3 ubiquitin-protein ligase MARCH4 (UniProt ID: Q9P2E8) is a 410-amino acid protein belonging to the RING-type E3 ligase family . Key features include:

  • Gene Synonyms: MARCHF4, RNF174, KIAA1399 .

  • Domains: Contains a C4HC3-type RING-CH domain critical for E2 enzyme binding and ubiquitin transfer .

  • Expression System: Produced in E. coli with an N-terminal His tag for purification .

Functional Roles

MARCH4 regulates substrate ubiquitination, influencing protein stability and trafficking:

  • Immune Regulation: Monoubiquitinates MHC-I molecules, triggering their endocytosis and lysosomal degradation to modulate antigen presentation .

  • Viral Defense: Shares functional homology with viral E3 ligases (e.g., KSHV K3/K5), suggesting roles in immune evasion .

  • Subcellular Localization: Primarily Golgi apparatus-resident, impacting vesicular trafficking .

Catalytic Mechanism

  1. E2 Recruitment: Binds E2 ubiquitin-conjugating enzymes via its RING-CH domain .

  2. Ubiquitin Transfer: Catalyzes substrate ubiquitination through a RING-dependent mechanism without forming E3-Ub intermediates .

Research Applications

Recombinant MARCH4 is utilized to study:

  • Ubiquitination Pathways: Mechanistic insights into substrate recognition and degradation .

  • Immune Checkpoint Regulation: Role in downregulating MHC-I/MHC-II and potential links to cancer immunotherapy .

  • Structural Biology: Crystallography and mutagenesis to map functional domains .

Recombinant Protein Properties

ParameterDetails
Expression HostEscherichia coli
Purification TagN-terminal His tag
Purity>90% (SDS-PAGE)
StorageLyophilized at -20°C/-80°C; reconstituted in Tris/PBS buffer with 6% trehalose
Reconstitution0.1–1.0 mg/mL in sterile water; 50% glycerol recommended for aliquots

Regulatory Mechanisms

  • Autoregulation: Undergoes autoubiquitination via its RING-CH domain, limiting its stability .

  • Phosphorylation: Activity modulated by kinases (e.g., TYRO3) and phosphatases (e.g., CDC25A) .

  • Deubiquitination: Stabilized by deubiquitinating enzymes like USP19 (homologous mechanism to MARCH6) .

Research Findings

  • MHC-I Downregulation: Overexpression of MARCH4 reduces MHC-I surface expression, mimicking viral immune evasion strategies .

  • Therapeutic Potential: Targeted inhibition of MARCH4 could enhance antitumor immunity by restoring MHC-I-mediated antigen presentation .

  • Mitochondrial Dynamics: While not directly studied for MARCH4, related MARCH proteins (e.g., MARCH5) regulate mitochondrial fission/fusion .

Challenges and Future Directions

  • Substrate Specificity: Limited data on non-MHC substrates warrant further proteomic studies.

  • Structural Insights: Full-length crystal structures are needed to elucidate substrate-binding interfaces.

  • Disease Links: Potential roles in autoimmune disorders or viral infections remain underexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MARCHF4; KIAA1399; MARCH4; RNF174; E3 ubiquitin-protein ligase MARCHF4; Membrane-associated RING finger protein 4; Membrane-associated RING-CH protein IV; MARCH-IV; RING finger protein 174; RING-type E3 ubiquitin transferase MARCHF4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-410
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
MARCH4
Target Protein Sequence
WYCYGLCAPAPQMLRHQGLLKCRCRMLFNDLKVFLLRRPPQAPLPMHGDPQPPGLAANNT LPALGAGGWAGWRGPREVVGREPPPVPPPPPLPPSSVEDDWGGPATEPPASLLSSASSDD FCKEKTEDRYSLGSSLDSGMRTPLCRICFQGPEQGELLSPCRCDGSVKCTHQPCLIKWIS ERGCWSCELCYYKYHVIAISTKNPLQWQAISLTVIEKVQVAAAILGSLFLIASISWLIWS TFSPSARWQRQDLLFQICYGMYGFMDVVCIGLIIHEGPSVYRIFKRWQAVNQQWKVLNYD KTKDLEDQKAGGRTNPRTSSSTQANIPSSEEETAGTPAPEQGPAQAAGHPSGPLSHHHCA YTILHILSHLRPHEQRSPPGSSRELVMRVTTV
Uniprot No.

Target Background

Function
MARCH4 (Membrane-Associated RING-CH 4) is an E3 ubiquitin-protein ligase that mediates the ubiquitination of MHC-I and CD4. This process promotes their endocytosis and subsequent lysosomal degradation via multivesicular bodies. E3 ubiquitin ligases receive ubiquitin from an E2 ubiquitin-conjugating enzyme as a thioester and directly transfer it to target substrates.
Gene References Into Functions
  1. Membrane-Associated RING-CH proteins MARCH VIII and MARCH IV associate with Bap31 and target CD81 and CD44 to lysosomes. PMID: 21151997
Database Links

HGNC: 29269

OMIM: 608208

KEGG: hsa:57574

STRING: 9606.ENSP00000273067

UniGene: Hs.170388

Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in brain and placenta.

Q&A

What is E3 ubiquitin-protein ligase MARCH4 and what cellular functions does it perform?

E3 ubiquitin-protein ligase MARCH4 belongs to the MARCH (Membrane-Associated Ring-CH) family of enzymes that participate in the three-enzyme ubiquitination cascade alongside ubiquitin activating enzyme E1 and ubiquitin conjugating enzyme E2. MARCH4 specifically catalyzes the transfer of ubiquitin protein to lysine residues on target substrates, playing an essential role in post-translational modification . Functionally, MARCH4 acts primarily as an immune regulator by downregulating cell surface expression of major histocompatibility complexes and immune co-stimulatory receptors. Recent studies have also demonstrated MARCH4's role in downregulating the inflammatory cytokine receptor for interleukin-6 (IL6Rα), indicating its broader significance in immune response modulation .

What are the primary cellular pathways influenced by MARCH4 activity?

MARCH4 influences several critical cellular pathways:

PathwayMARCH4 FunctionResearch Significance
Immune Response RegulationDownregulates MHC I/II and co-stimulatory moleculesCritical for understanding immune evasion mechanisms
Inflammatory SignalingModulates IL6Rα surface expressionImportant in inflammatory disorders and cancer
Protein Quality ControlContributes to removal of misfolded membrane proteinsRelevant for neurodegenerative disease research
Cell Surface Receptor TurnoverRegulates density of various receptor populationsImpacts cellular sensitivity to external signals

These pathways position MARCH4 as a significant regulator at the intersection of immune function and protein homeostasis, with profound implications for both normal physiology and disease states .

What are the optimal expression systems for producing functional recombinant MARCH4 protein?

The production of functional recombinant MARCH4 presents unique challenges due to its membrane-associated nature. For optimal expression, mammalian cell systems typically yield the highest functionality, with HEK293 cells being particularly effective when transfected with vectors containing the full MARCH4 open reading frame (Q80TE3) . The expression construct should include:

  • A strong promoter (CMV is commonly used)

  • A cleavable signal peptide for proper membrane localization

  • A small epitope tag (FLAG or His) positioned to avoid interference with the RING-CH domain

When designing expression experiments, researchers should implement inducible expression systems to mitigate potential cytotoxicity from MARCH4 overexpression, which can disrupt cellular ubiquitination homeostasis. For structural studies requiring higher protein yields, insect cell systems (Sf9 or High Five) can be utilized with baculovirus vectors, though additional optimization of detergent conditions is necessary to maintain the native conformation of the membrane-spanning regions .

What experimental controls are essential when studying MARCH4-mediated ubiquitination?

Rigorous experimental design for MARCH4 studies requires multiple control conditions to ensure valid interpretation of ubiquitination data:

  • Catalytically inactive MARCH4 mutant: Introducing point mutations in the RING-CH domain (typically cysteine to alanine substitutions) creates an essential negative control that maintains binding capacity while eliminating catalytic activity.

  • Substrate lysine mutants: For suspected MARCH4 targets, generating lysine-to-arginine mutations at potential ubiquitination sites helps confirm specific modification sites.

  • Proteasome inhibitors: Including MG132 or bortezomib treatments distinguishes between degradative and non-degradative ubiquitination outcomes.

  • Deubiquitinase inhibitors: Adding N-ethylmaleimide or other DUB inhibitors prevents reversal of ubiquitination, enhancing detection sensitivity.

  • Related MARCH family proteins: Including MARCH2, MARCH3, and MARCH9 as comparative controls helps distinguish MARCH4-specific effects from general MARCH family functions .

How should researchers design experiments to investigate MARCH4-mediated downregulation of cell surface receptors?

Investigating MARCH4's effect on cell surface receptors requires a multi-faceted experimental approach:

  • Flow cytometry time-course analysis: Establish baseline receptor levels, then induce MARCH4 expression and monitor receptor downregulation over 6-48 hours using fluorescently-labeled antibodies against the receptor of interest.

  • Surface biotinylation and internalization assays: Label all surface proteins with biotin, then track the fate of biotinylated receptors after MARCH4 induction to distinguish between internalization, degradation, and recycling pathways.

  • Immunoprecipitation coupled with ubiquitination detection: Pull down the receptor of interest and probe for ubiquitin modifications using linkage-specific antibodies to determine the type of ubiquitin chain (K48, K63, etc.) being added by MARCH4.

  • Confocal microscopy co-localization: Visualize the spatial and temporal relationship between MARCH4, target receptors, and endosomal/lysosomal markers to elucidate trafficking patterns.

When designing these experiments, researchers should account for potential experimental errors such as antibody cross-reactivity or incomplete protein extraction that could affect data integrity and interpretation .

How can proteomics approaches be optimized to identify novel MARCH4 substrates?

Comprehensive identification of MARCH4 substrates requires specialized proteomic strategies that overcome the challenges of detecting transient ubiquitination events:

  • Cell surface proteomic profiling: Using controlled MARCH4 overexpression in model cell lines such as M1 myeloid leukemia cells provides a powerful system for identifying cell surface proteins regulated by MARCH4 . This approach should incorporate stable isotope labeling (SILAC) to compare MARCH4-expressing and control cells, followed by surface biotinylation, streptavidin pulldown, and quantitative mass spectrometry.

  • Proximity-based biotinylation: Expressing MARCH4 fused to a proximity labeling enzyme (BioID or TurboID) enables biotinylation of proteins that transiently interact with MARCH4, providing a broader picture of its substrate landscape.

  • Ubiquitin remnant profiling: Following tryptic digestion, antibodies recognizing the di-glycine remnant left on ubiquitinated lysines can enrich for ubiquitination sites. Comparing samples with and without MARCH4 expression reveals MARCH4-dependent ubiquitination events.

  • Integrative data analysis: Cross-referencing datasets from these complementary approaches using correlation analysis and pathway enrichment tools helps prioritize high-confidence MARCH4 substrates for validation.

When analyzing proteomic data, researchers should implement statistical approaches that account for both magnitude of change and consistency across replicates, as MARCH4 may exert subtle effects on some targets while dramatically affecting others .

What are the most effective strategies for investigating MARCH4's role in immune regulation?

Investigating MARCH4's immunoregulatory functions requires specialized experimental designs that capture its effects on immune cell function:

  • Conditional knockout systems: Generating cell-specific or inducible MARCH4 knockout models using Cre-lox or CRISPR-Cas9 technology in immune cell populations provides insights into cell-autonomous effects.

  • Ex vivo immune cell functional assays: Isolating primary immune cells from MARCH4-modified systems and assessing their antigen presentation capacity, cytokine production, and activation threshold reveals functional consequences of MARCH4 activity.

  • In vivo immune challenge models: Subjecting MARCH4-deficient organisms to pathogen challenges, autoimmune induction, or tumor implantation reveals systemic immunological roles.

  • Single-cell analysis pipelines: Combining single-cell RNA sequencing with surface protein analysis (CITE-seq) identifies cell populations most affected by MARCH4 activity and reveals compensatory mechanisms.

The experimental approach should include appropriate sampling methods, controls for potential confounding variables, and statistical analyses that account for the heterogeneity inherent in immune cell populations .

How can researchers effectively study the interplay between MARCH4 and other E3 ligases in coordinating ubiquitination networks?

Investigating the cooperative or antagonistic relationships between MARCH4 and other E3 ligases requires sophisticated experimental designs:

  • Combinatorial knockdown/overexpression: Systematically manipulating MARCH4 expression alongside other E3 ligases (particularly other MARCH family members) using siRNA, shRNA, or CRISPR approaches reveals functional redundancy or synergy.

  • Protein-protein interaction mapping: Deploying BioID, co-immunoprecipitation, or yeast two-hybrid screening identifies direct interactions between MARCH4 and other components of ubiquitination machinery.

  • Ubiquitinome analysis under varied conditions: Comparing global ubiquitination patterns when MARCH4 is active versus inactive, and in the presence or absence of other E3 ligases, reveals their collective impact on the cellular ubiquitination landscape.

  • Mathematical modeling: Developing computational models that incorporate enzyme kinetics, substrate availability, and cellular localization predicts how these E3 ligases function as a network.

What are common pitfalls in interpreting MARCH4 ubiquitination data and how can they be avoided?

Interpretation of MARCH4 ubiquitination data presents several challenges that require careful consideration:

How should researchers resolve contradictory findings about MARCH4 function in different experimental systems?

When confronted with contradictory results regarding MARCH4 function across different experimental systems, researchers should implement a systematic troubleshooting approach:

  • Experimental system audit: Compare key parameters between contradictory studies:

ParameterConsiderationPotential Impact
Cell/Tissue TypeDifferent cellular contextsAltered cofactor availability or substrate expression
Expression LevelEndogenous vs. overexpressionNon-physiological targeting or dominant-negative effects
Fusion TagsSize, position, and nature of tagsInterference with MARCH4 localization or activity
Experimental TimeframeAcute vs. chronic manipulationCompensation or adaptation mechanisms
Detection MethodsSensitivity and specificity differencesFalse positives or negatives
  • Bridging experiments: Design experiments that systematically vary key parameters one at a time to identify the specific condition causing divergent results.

  • Orthogonal validation: Employ multiple independent techniques to assess the same biological outcome, reducing technique-specific artifacts.

  • Biological context consideration: Recognize that apparently contradictory findings may reflect genuine biological complexities rather than experimental errors .

What strategies help optimize detection of low-abundance or transient MARCH4-mediated ubiquitination events?

Detecting low-abundance or transient MARCH4-mediated ubiquitination presents significant technical challenges that require specialized approaches:

  • Stabilization of ubiquitinated intermediates:

    • Use proteasome inhibitors (MG132, bortezomib) to prevent degradation of K48-linked substrates

    • Apply deubiquitinase inhibitors (PR-619, NEM) to prevent removal of ubiquitin modifications

    • Employ temperature shifts (reduced temperature culturing) to slow trafficking and degradation

  • Signal amplification techniques:

    • Implement ubiquitin remnant enrichment before mass spectrometry

    • Use proximity ligation assays to visualize MARCH4-substrate interactions

    • Apply fluorescence resonance energy transfer (FRET) between MARCH4 and substrates

  • Temporal optimization:

    • Conduct fine-grained time course experiments to capture optimal windows for detection

    • Employ pulse-chase approaches to track the fate of newly synthesized potential substrates

    • Synchronize cells to enhance detection during specific cell cycle phases when relevant

  • Computational prediction and targeted investigation:

    • Use bioinformatic tools to predict likely MARCH4 substrates based on sequence motifs

    • Focus detection efforts on predicted substrates using targeted proteomics approaches (PRM or MRM)

    • Develop machine learning algorithms trained on known targets to predict new candidates

How might single-cell approaches advance our understanding of MARCH4 function in heterogeneous tissues?

Single-cell technologies offer unprecedented opportunities to dissect MARCH4 function within complex tissue environments:

  • Single-cell multi-omics integration: Combining scRNA-seq, scATAC-seq, and single-cell proteomics reveals how MARCH4 expression correlates with chromatin accessibility, transcriptional programs, and protein levels across diverse cell populations. This integrated approach can identify cell types where MARCH4 plays particularly critical roles and reveal regulatory networks governing its activity.

  • Spatial transcriptomics and proteomics: Techniques such as Visium, MERFISH, or imaging mass cytometry maintain spatial information while quantifying MARCH4 expression and activity, enabling researchers to map MARCH4 function within tissue microenvironments and identify spatial regulatory patterns previously undetectable in bulk analyses.

  • Live cell single-molecule tracking: Visualizing individual MARCH4 molecules in living cells using techniques like SPT-PALM provides dynamic information about MARCH4 movement, interaction kinetics, and localization within membrane microdomains. These approaches reveal how MARCH4 finds and engages its substrates in real-time.

  • Single-cell CRISPR perturbations: Combinatorial CRISPR screens at single-cell resolution enable systematic investigation of genetic interactions with MARCH4, identifying synthetic lethal relationships and compensatory mechanisms that maintain cellular homeostasis when MARCH4 function is compromised .

What are the most promising therapeutic applications targeting MARCH4 activity in disease contexts?

Emerging research highlights several promising therapeutic avenues involving MARCH4 modulation:

  • Cancer immunotherapy enhancement: Selective inhibition of MARCH4 in tumors or antigen-presenting cells could enhance MHC presentation and co-stimulatory molecule expression, potentially breaking tumor immune tolerance and improving response to checkpoint inhibitors. Early studies suggest that MARCH4 inhibition could synergize with existing immunotherapies by making tumors more visible to the immune system .

  • Inflammatory disorder management: In contexts where excessive inflammation drives pathology, selective MARCH4 activators or stabilizers could enhance downregulation of inflammatory receptors like IL6Rα, dampening inflammatory cascades. This approach might offer more selective immunosuppression than current broad-spectrum agents .

  • Targeted protein degradation platforms: Engineered MARCH4-based PROTACs (Proteolysis Targeting Chimeras) could harness MARCH4's membrane protein ubiquitination capacity to selectively degrade otherwise "undruggable" membrane proteins implicated in disease. The membrane-associated nature of MARCH4 makes it particularly suited for targeting plasma membrane proteins resistant to conventional TPD approaches .

  • Neurodegenerative disease intervention: Given the role of ubiquitination in protein quality control, modulating MARCH4 activity could enhance clearance of misfolded membrane proteins implicated in conditions like Alzheimer's or Parkinson's disease. MARCH4-based approaches could offer an alternative mechanism to address protein aggregation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.