Recombinant Human E3 ubiquitin-protein ligase RNF144B (RNF144B)

Shipped with Ice Packs
In Stock

Description

General Information

RNF144B, or Ring Finger Protein 144B, is an E3 ubiquitin ligase in humans . E3 ubiquitin ligases are enzymes that facilitate the transfer of ubiquitin to specific protein substrates, marking these proteins for degradation or altering their function . RNF144B is involved in regulating innate immunity and has been linked to diseases such as gastric cancer .

Role in Innate Immunity

RNF144B negatively regulates the activation of IRF3 (Interferon Regulatory Factor 3) and the production of IFN-beta (Interferon beta), both of which are crucial components of the innate immune response . Mechanistically, RNF144B inhibits TBK1 phosphorylation, an essential step in the activation of interferon (IFN) signaling .

A recent study in Rnf144b knockout mice demonstrated that RNF144B targets the CARDs of MDA5 and mediates autophagic degradation of MDA5, thus negatively regulating the innate antiviral response . Rnf144b knockout mice exhibited a higher survival rate upon EMCV infection compared to wild-type mice, suggesting that RNF144B deficiency enhances the antiviral response .

Key findings from the study include :

  • RNF144B facilitates the degradation of MDA5.

  • RNF144B promotes K27- and K33-linked ubiquitination of MDA5.

  • RNF144B promotes p62-mediated selective autophagic degradation of MDA5.

2.1. Impact on Viral Infections

RNF144B specifically regulates RNA virus-induced IFN signaling without significantly inhibiting the replication of DNA viruses like HSV . While RNF144B deficiency impacts VSV replication, it does not affect RIG-I degradation, suggesting it may influence RIG-I's functional activity through post-translational modifications like ubiquitination .

RNF144B and Gastric Cancer

Low expression of RNF144B is associated with gastric cancer, indicating a potential tumor-suppressor role .

RNF144B Regulation of DNA-PKcs and Apoptosis

A study on RNF144A, a related protein, showed that it induces ubiquitination of DNA-PKcs in vitro and in vivo and promotes its degradation . RNF144A is induced in a p53-dependent manner during DNA damage and targets cytosolic DNA-PKcs for ubiquitination and degradation . The regulation of DNA-PKcs by RNF144A is important for proper apoptotic response during DNA damage, suggesting a tumor suppressor function for RNF144A .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
RNF144B; IBRDC2; P53RFP; E3 ubiquitin-protein ligase RNF144B; IBR domain-containing protein 2; RING finger protein 144B; p53-inducible RING finger protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
RNF144B
Target Protein Sequence
MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIFCTACLKQY MQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPYRTW CPVADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRA LFGTDAEAPIKQCPVCRVYIERNEGCAQMMCKNCKHTFCWYCLQNLDNDIFLRHYDKGPC RNKLGHSRASVMWNRTQVVGILVGLGIIALVTSPLLLLASPCIICCVCKSCRGKKKKHDP STT
Uniprot No.

Target Background

Function

RNF144B is an E3 ubiquitin-protein ligase that accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6. It then directly transfers the ubiquitin to target substrates, such as LCMT2, promoting their degradation. RNF144B induces apoptosis through a p53/TP53-dependent, caspase-independent mechanism. Paradoxically, its overexpression can also decrease the ubiquitin-dependent stability of the pro-apoptotic protein BAX, thus offering some protection against cell death. However, it is not considered an anti-apoptotic protein itself.

Gene References Into Functions
  1. Low RNF144B expression is associated with gastric cancer. PMID: 27524417
  2. Research indicates PIR2/Rnf144b as a crucial regulator of epithelial homeostasis, acting downstream of DeltaNp63alpha to modulate cellular levels of p21(WAF1/CIP1) and DeltaNp63alpha. PMID: 23128396
  3. PIR2 is induced by TAp73 and degrades DeltaNp73, differentially regulating TAp73/DeltaNp73 stability. PMID: 20615966
  4. PIR2/RNF144B/IBRDC2 regulates the stability of TAp73 and DNp73. PMID: 20615966
  5. Clinical trial data on gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
  6. IBRDC2, an IBR-type RING-finger E3 ubiquitin ligase, regulates Bax levels and protects cells from spontaneous Bax activation and cell death. PMID: 20300062
  7. p53RFP, a p53-inducible RING-finger protein, regulates p21WAF1 stability. PMID: 12853982
Database Links

HGNC: 21578

KEGG: hsa:255488

STRING: 9606.ENSP00000259939

UniGene: Hs.148741

Protein Families
RBR family, RNF144 subfamily
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein. Cytoplasm. Note=Mostly cytosololic, accumulates in submitochondrial domains specifically upon apoptosis induction, in synchrony with BAX activation.
Tissue Specificity
Broadly expressed, with lowest levels in brain and thymus, and highest levels detectable in heart, ovary and testis.

Q&A

What is RNF144B and what are its primary functions?

RNF144B is an E3 ubiquitin-protein ligase that accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes (UBE2L3 and UBE2L6) as a thioester intermediate and then directly transfers the ubiquitin to targeted substrate proteins. It belongs to the RBR (RING-Between-RING) family, specifically the RNF144 subfamily .

Functionally, RNF144B:

  • Promotes degradation of target substrates through ubiquitination

  • Induces apoptosis via a p53/TP53-dependent but caspase-independent mechanism

  • Regulates inflammatory responses in various contexts

  • Modulates antiviral immune responses

For proper experimental characterization, researchers should verify its E3 ligase activity using in vitro ubiquitination assays with purified components, as demonstrated with related E3 ligases like RNF144A .

What cellular compartments contain RNF144B?

RNF144B exhibits multi-compartmental localization that researchers should consider when designing experiments:

  • Cytoplasm and cytosol

  • Integral to cellular membranes

  • Associated with mitochondrial membranes

  • Present in ubiquitin ligase complexes

When conducting subcellular fractionation or localization studies, use multiple markers for each compartment to confirm RNF144B distribution. Immunofluorescence microscopy with appropriate controls and co-localization studies with organelle-specific markers will provide reliable spatial information.

How is RNF144B regulated at the transcriptional level?

RNF144B transcriptional regulation shows important species-specific differences:

  • In humans: RNF144B is lipopolysaccharide (LPS)-inducible in primary macrophages and THP-1 cells

  • In mice: Rnf144b is not LPS-inducible in several cell populations, including primary macrophages from C57BL/6 and BALB/c mice and RAW264.7 macrophages

  • Rnf144b was not up-regulated by infection of C57BL/6 mice with Escherichia coli

While human and mouse RNF144B genes have conserved transcription start sites, cap analysis of gene expression (CAGE) data confirmed that the RNF144B promoter directs transcription in human but not mouse macrophages. Both species have highly conserved TATA-containing promoters, but subtle differences in transcription factor binding sites may account for differential regulation .

How can researchers effectively study RNF144B in experimental systems?

When designing experiments to study RNF144B:

  • Species selection is critical: Consider the significant differences between human and mouse RNF144B regulation

  • Cell-type specificity: Select appropriate cell models based on expression patterns (e.g., human macrophages express RNF144B after LPS stimulation)

  • Stimulation protocols: Use appropriate stimuli depending on the pathway being studied:

    • LPS for inflammasome studies

    • Viral infection for antiviral response studies

  • Knockout/knockdown validation: Confirm efficiency at both mRNA and protein levels

  • Functional readouts: Measure appropriate downstream effects:

    • Cytokine production (IL-1β, IFN-β)

    • Target protein degradation

    • Ubiquitination status of putative substrates

What is the mechanism of RNF144B-mediated ubiquitination?

RNF144B functions as a RING/HECT hybrid E3 ligase through its RBR domain architecture:

  • Initial mechanism: Uses RING1 domain to bind E2 enzymes (UBE2L3 and UBE2L6)

  • Intermediate step: Forms a thioester linkage with ubiquitin through a conserved cysteine residue in the RING2 domain, similar to HECT-type E3 ligases

  • Transfer mechanism: Directly transfers ubiquitin to targeted substrates like LCMT2

Experimental approaches to study this mechanism:

  • In vitro ubiquitination assays using purified components

  • Site-directed mutagenesis of key catalytic residues (particularly conserved cysteines)

  • Thioester-trapping experiments to capture RNF144B~ubiquitin intermediates

  • Mass spectrometry to identify ubiquitination sites on substrates

Similar to related E3 ligase RNF144A, the transmembrane domain may play a crucial regulatory role in RNF144B activity. Studies with RNF144A showed that truncation of either the RBR domain or the transmembrane domain abolished ubiquitination activity .

How does RNF144B regulate inflammatory responses?

RNF144B plays complex roles in inflammatory responses:

  • Inflammasome regulation:

    • Necessary for priming of inflammasome responses in human macrophages

    • Promotes LPS-inducible IL-1β mRNA expression

    • Does not regulate other LPS-inducible cytokines (IL-10, IFN-γ) or affect expression of inflammasome components (procaspase-1, pro-IL-18)

  • Anti-inflammatory effects in sepsis:

    • Alleviates inflammatory responses in sepsis models

    • Ameliorates cardiac complications in sepsis

    • Suppressing inflammation through RNF144B may help treat sepsis

Researchers investigating these aspects should:

  • Use appropriate inflammatory models (LPS stimulation, CLP sepsis model)

  • Measure both mRNA and protein levels of inflammatory markers

  • Assess cell-type specific effects

  • Consider species differences in experimental design

What is known about RNF144B's role in antiviral immunity?

RNF144B functions as a negative regulator of antiviral immunity with several key mechanisms:

  • MDA5 targeting:

    • RNF144B targets the CARD domains of MDA5 (melanoma differentiation-associated protein 5)

    • Mediates autophagic degradation of MDA5, reducing antiviral responses

  • Impact on viral infection:

    • Rnf144b knockout mice show significantly higher survival rates upon EMCV (encephalomyocarditis virus) infection

    • Knockout mice exhibit elevated levels of IFN-β in serum compared to wild-type mice

    • RNF144B deficiency inhibits VSV (vesicular stomatitis virus) replication

  • Specificity of regulation:

    • RNF144B specifically regulates RNA virus-induced IFN signaling

    • Does not significantly affect DNA virus (HSV) replication

    • Regulation depends on its E3 ubiquitin ligase activity

Experimental considerations for studying RNF144B in antiviral immunity:

  • Use both RNA viruses (EMCV, VSV) and DNA viruses (HSV) to assess specificity

  • Measure interferon responses at multiple levels (mRNA, protein, signaling pathway activation)

  • Include both in vitro and in vivo models when possible

  • Assess virus-specific effects by using multiple virus types

How does RNF144B differ from related E3 ligases like RNF144A?

Understanding the similarities and differences between RNF144B and related E3 ligases:

FeatureRNF144BRNF144A
Domain architectureRBR domain, transmembrane domainRBR domain, transmembrane domain
InductionLPS-inducible in human macrophages, p53-regulatedDNA damage-inducible in a p53-dependent manner
Known substratesMDA5, LCMT2DNA-PKcs
Role in apoptosisInduces apoptosis via p53-dependent mechanism; can also protect against cell death by decreasing BAX stabilityPromotes apoptosis during DNA damage
Cellular localizationCytoplasmic, membrane-associatedCytoplasmic vesicles, plasma membrane
Species differencesHuman-specific LPS inductionNot reported

While both proteins share 71% amino acid homology and similar domain architecture, they appear to have distinct functions and regulatory mechanisms. RNF144A targets cytosolic DNA-PKcs for ubiquitination and degradation, promoting apoptosis during DNA damage response , while RNF144B has more established roles in inflammatory and antiviral responses .

What experimental approaches are most effective for studying RNF144B ubiquitination activity?

To study RNF144B E3 ligase activity:

  • In vitro ubiquitination assays:

    • Purify recombinant GST-RNF144B or other tagged versions

    • Combine with purified E1, appropriate E2 enzymes (UBE2L3, UBE2L6), ubiquitin, ATP, and potential substrates

    • Detect ubiquitination by western blot using anti-ubiquitin antibodies

    • Similar to methods used for RNF144A, which demonstrated both auto-ubiquitination and substrate ubiquitination

  • Cellular ubiquitination assays:

    • Overexpress HA-tagged ubiquitin and RNF144B in appropriate cell lines

    • Immunoprecipitate potential substrates and detect ubiquitination

    • Use proteasome inhibitors (MG132) to prevent degradation of ubiquitinated proteins

    • Compare wild-type with catalytic mutants (mutations in RING1 or RING2 domains)

  • Identification of substrates:

    • Proximity-based labeling approaches (BioID, TurboID)

    • Quantitative proteomics comparing protein levels in wild-type vs. RNF144B knockout cells

    • Co-immunoprecipitation followed by mass spectrometry

    • In silico prediction of interaction motifs combined with experimental validation

  • Critical controls:

    • Catalytically inactive mutants (RING1-dead mutant C20A/C23A, RING2/HECT-inactive mutant C198A)

    • Domain deletion constructs (ΔRBR, ΔTM)

    • E2 enzyme specificity tests

How can RNF144B be effectively targeted or modulated in disease contexts?

Based on current research findings, several strategies could be employed:

  • For inflammatory conditions and sepsis:

    • Upregulation or activation of RNF144B may alleviate inflammatory responses

    • Small molecule enhancers of RNF144B E3 ligase activity could be therapeutic

    • Methodologies: Screen for compounds that enhance RNF144B stability or activity

  • For viral infections:

    • Inhibition of RNF144B might enhance antiviral immunity

    • RNF144B inhibitors could potentially boost immune responses to RNA viruses

    • Methodologies: Design peptide-based inhibitors targeting RNF144B-MDA5 interaction

  • Experimental approaches:

    • PROTAC (Proteolysis Targeting Chimera) technology to degrade RNF144B

    • Peptide-based inhibitors targeting the catalytic domain

    • Gene therapy approaches for tissue-specific modulation

    • Monoclonal antibodies against extracellular domains

  • Disease-specific considerations:

    • For sepsis: RNF144B activation may be beneficial

    • For viral infections: RNF144B inhibition may enhance immunity

    • For inflammatory disorders: Context-dependent approach needed

What are the optimal conditions for working with recombinant RNF144B protein?

When working with recombinant RNF144B:

  • Storage and handling:

    • Store at recommended temperatures (typically -80°C for long-term)

    • Avoid repeated freeze-thaw cycles

    • Small volumes may become entrapped in the seal of product vials during shipment

  • Buffer considerations:

    • For E3 ligase activity assays: Tris-HCl pH 7.5, NaCl, MgCl₂, DTT, ATP

    • For interaction studies: Consider physiological pH and salt conditions

    • For membrane protein studies: Include appropriate detergents to maintain solubility

  • Expression systems:

    • Bacterial expression may be challenging due to transmembrane domain

    • Consider eukaryotic expression systems for proper folding and post-translational modifications

    • Insect cell or mammalian cell expression systems often yield better results for membrane-associated proteins

  • Special considerations:

    • As an integral membrane protein, complete solubilization may require specialized detergents

    • Consider using only the catalytic domain for some applications

    • Validate protein activity using auto-ubiquitination assays

How can researchers address species-specific differences when studying RNF144B?

Given the significant species-specific differences in RNF144B regulation:

  • Model selection guidelines:

    • For inflammatory studies in macrophages, human cells are preferable given LPS-inducibility

    • For in vivo studies, consider humanized mouse models or be aware of interpretation limitations

    • Include both human and mouse systems for comparative studies

  • Cross-species validation strategies:

    • Validate findings in both human and mouse systems whenever possible

    • Use primary cells rather than cell lines when feasible

    • For mouse studies, explicitly acknowledge potential disconnects from human biology

  • Technical approaches:

    • Use species-specific antibodies validated for specificity

    • Design primers that account for sequence differences between species

    • Consider knock-in approaches to humanize mouse Rnf144b when appropriate

  • Data interpretation:

    • Exercise caution when extrapolating mouse findings to human systems

    • Contextualize results within the species-specific regulatory landscape

    • Consider evolutionary aspects that may explain functional differences

What are the key unresolved questions about RNF144B?

Several critical knowledge gaps remain in RNF144B research:

  • Comprehensive substrate identification:

    • Beyond the few known targets (MDA5, LCMT2), what is the complete repertoire of RNF144B substrates?

    • How does substrate specificity differ between tissues and cellular contexts?

    • Methods: Proximity labeling combined with proteomics, ubiquitinome analysis

  • Regulatory mechanisms:

    • What factors control RNF144B expression beyond LPS and p53?

    • How is RNF144B activity post-translationally regulated?

    • What triggers RNF144B degradation?

  • Structure-function relationships:

    • Crystal structure of RNF144B remains unresolved

    • How does the transmembrane domain influence catalytic activity?

    • What are the key residues for substrate recognition?

  • Therapeutic potential:

    • Can RNF144B modulation be leveraged for treatment of inflammatory disorders?

    • What are the potential off-target effects of RNF144B inhibition or activation?

    • How does RNF144B participate in disease progression beyond current known functions?

How can researchers better understand the dual role of RNF144B in cell death regulation?

RNF144B shows context-dependent effects on cell survival:

  • Research strategies to resolve this duality:

    • Conduct time-course studies to determine temporal aspects of RNF144B function

    • Investigate cell-type specific effects through conditional knockout models

    • Identify the molecular switches that determine pro-survival versus pro-death functions

    • Examine the interplay between RNF144B and key apoptotic regulators beyond BAX

  • Experimental approaches:

    • Live-cell imaging with fluorescent reporters for apoptotic events

    • CRISPR-Cas9 gene editing to create domain-specific mutants

    • Single-cell analysis to capture heterogeneity in responses

    • Combinatorial targeting of RNF144B with other cell death modulators

Why might detection of endogenous RNF144B be challenging?

Researchers frequently encounter difficulties detecting endogenous RNF144B:

  • Expression level challenges:

    • Baseline expression may be low in many cell types

    • Consider appropriate stimulation (e.g., LPS for human macrophages)

    • Enrich membrane fractions when working with whole-cell lysates

  • Antibody selection and validation:

    • Test multiple antibodies from different vendors

    • Validate specificity using knockout/knockdown controls

    • Consider epitope accessibility (N-terminal vs. C-terminal antibodies)

  • Detection strategies:

    • Use immunoprecipitation to concentrate protein before western blotting

    • Consider more sensitive detection methods (chemiluminescence, fluorescence)

    • For low abundance proteins, targeted mass spectrometry may be more reliable than antibody-based methods

  • Species-specific considerations:

    • Ensure antibodies are validated for your species of interest

    • Be aware of potential cross-reactivity with RNF144A

What are common pitfalls in studying RNF144B-mediated ubiquitination?

When investigating RNF144B-mediated ubiquitination:

  • Technical challenges:

    • Difficulty distinguishing polyubiquitination from monoubiquitination at multiple sites

    • Potential loss of ubiquitination during cell lysis and processing

    • Competition from deubiquitinating enzymes

  • Experimental solutions:

    • Include deubiquitinase inhibitors in lysis buffers

    • Use denaturing conditions to disrupt protein interactions

    • Consider ubiquitin mutants to distinguish between different chain types

    • Use mass spectrometry to identify specific ubiquitination sites

  • Control considerations:

    • Include catalytically inactive mutants as negative controls

    • Use E2 enzyme selectivity controls

    • Test for non-specific ubiquitination in overexpression systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.