Recombinant Human E3 ubiquitin-protein ligase RNF152 (RNF152)

Shipped with Ice Packs
In Stock

Description

Biological Roles and Pathway Regulation

RNF152 governs multiple signaling pathways through enzymatic and non-enzymatic mechanisms:

mTORC1 Regulation

RNF152 negatively regulates mTORC1 by ubiquitinating key components:

  • RagA (K63-linked): Inhibits amino acid-induced mTORC1 activation .

  • Rheb (Monoubiquitination): Blocks EGF-driven mTORC1 signaling .

  • TSC2 (K63-linked): Amplifies mTORC1 inhibition, particularly under nutrient stress .

Experimental Evidence:

SubstrateUbiquitination TypeEffect on mTORC1Model SystemSource
RagAK63-linkedInhibitionHEK293T cells
RhebMonoubiquitinationInhibitionHEK293T cells
TSC2K63-linkedEnhanced inhibitionHEK293T cells

TLR/IL-1R Signaling

RNF152 enhances MyD88 oligomerization, a critical step in NF-κB activation, independently of its E3 ligase activity .

  • Mechanism: Stabilizes MyD88 self-association via membrane localization .

  • Outcome: Increased pro-inflammatory cytokine production (e.g., IL-6, TNF-α) .

Key Findings:

ConditionRNF152 ActivityMyD88 OligomerizationNF-κB ActivationSource
OverexpressionWild-type
E3-deficient mutantInactive
TM domain deletionWild-type

Wnt/β-catenin Signaling

RNF152 suppresses Wnt signaling in Xenopus embryos, likely by modulating lysosomal membrane dynamics .

  • Mechanism: Membrane localization-dependent, E3 activity-independent inhibition .

Pro-Apoptotic and Lysosomal Functions

RNF152 overexpression induces apoptosis in Hela cells, linked to lysosomal localization and K48-linked self-ubiquitination . Its role in apoptosis is context-dependent, potentially involving lysosomal membrane integrity .

Recombinant RNF152 in Research

Recombinant RNF152 is produced via bacterial (e.g., E. coli) or mammalian expression systems for functional studies .

Applications:

Use CaseExample ExperimentOutcomeSource
In vitro ubiquitinationAssay with RagA/TSC2 substratesK63-linked chain formation
Cell culture modulationHEK293T overexpression for mTORC1 studiesAltered 4EBP1 phosphorylation
Structural analysisCo-IP with MyD88 to study oligomerizationEnhanced Myddosome assembly

Therapeutic Potential and Challenges

  • Specificity: Off-target effects due to broad substrate interaction.

  • Stability: Short half-life due to autoubiquitination .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RNF152; E3 ubiquitin-protein ligase RNF152; RING finger protein 152; RING-type E3 ubiquitin transferase RNF152
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGVTKL PPGFSVSQLPDDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERALLPGDMGCR LLPGSQQKSVTVVTIPAEQQPLQGGAPQEAVEEEQDRRGVVKSSTWSGVCTVILVACVLV FLLGIVLHNMSCISKRFTVISCG
Uniprot No.

Target Background

Function

Recombinant Human E3 ubiquitin-protein ligase RNF152 (RNF152) is an E3 ubiquitin-protein ligase that mediates Lys-63-linked polyubiquitination of RRAGA in response to amino acid starvation. This regulation affects mTORC1 signaling and the cellular response to amino acid availability. RNF152 also mediates Lys-48-linked polyubiquitination of target proteins, leading to proteasomal degradation. Overexpression of RNF152 induces apoptosis.

Gene References Into Functions
  1. A mechanism for regulation of mTORC1 signaling by RNF152-mediated K63-linked polyubiquitination of RagA. PMID: 25936802
  2. RNF152 is a lysosome-localized E3 ligase with pro-apoptotic activities. PMID: 21203937
  3. Observational study of gene-disease association. (HuGE Navigator) PMID: 19240061
Database Links

HGNC: 26811

OMIM: 616512

KEGG: hsa:220441

STRING: 9606.ENSP00000316628

UniGene: Hs.165062

Protein Families
RNF152 family
Subcellular Location
Lysosome membrane; Single-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is RNF152 and what are its key structural features?

RNF152 is an E3 ubiquitin-protein ligase characterized by two critical structural domains: a RING finger domain that mediates its catalytic function and a transmembrane (TM) domain that facilitates its subcellular localization. The RING domain enables the protein to catalyze the transfer of ubiquitin to substrate proteins, while the TM domain anchors RNF152 to cellular membranes, particularly lysosomal membranes .

The E3 ligase activity of RNF152 mediates both 'Lys-63'-linked polyubiquitination of substrates like RRAGA (RagA GTPase) and autoubiquitination that regulates its own half-life . Interestingly, while its E3 ligase activity is essential for some functions like mTORC1 regulation, other functions such as TLR/IL-1R signaling enhancement operate independently of this enzymatic activity .

Research has established that mutant variants lacking either the RING domain (RNF152-ΔR) or containing a point mutation (RNF152-C30S) demonstrate impaired autoubiquitination but can still function in certain signaling pathways, highlighting the complex multifunctional nature of this protein .

Which signaling pathways does RNF152 regulate?

RNF152 functions as a regulatory node in multiple critical signaling networks:

  • TLR/IL-1R Signaling: RNF152 positively regulates Toll-like receptor (TLR) and interleukin-1 receptor (IL-1R) signaling by enhancing MyD88 oligomerization in an E3 ligase-independent manner. This facilitates the assembly of the Myddosome, a critical signaling complex that promotes downstream inflammatory responses .

  • mTORC1 Pathway: RNF152 negatively regulates mechanistic target of rapamycin complex 1 (mTORC1) signaling by mediating K63-linked polyubiquitination of RagA GTPase in response to amino acid starvation. This ubiquitination activates GATOR1, an inhibitor of RagA, thereby suppressing mTORC1 activity .

  • Wnt/β-catenin Signaling: RNF152 acts as a negative regulator of the Wnt/β-catenin pathway by interfering with Dishevelled (Dsh) polymerization. This disruption prevents proper signalosome formation, thereby inhibiting downstream Wnt-dependent transcriptional activities .

  • Neuronal Development Pathways: RNF152 plays essential roles in neurogenesis through NeuroD expression regulation and Delta-Notch signaling modulation, potentially linking mTORC1 signaling to neuronal development processes .

These diverse regulatory functions establish RNF152 as a multifaceted signaling modulator whose activity varies depending on cellular context and pathway activation status.

How does RNF152 expression affect inflammatory responses?

RNF152 significantly impacts inflammatory responses primarily through its regulatory effects on TLR/IL-1R signaling pathways. Studies using RNF152-deficient mice have demonstrated that these animals produce substantially lower levels of inflammatory cytokines when challenged with lipopolysaccharide (LPS), a potent TLR4 agonist .

The in vivo relevance of these findings was demonstrated in an LPS-induced endotoxemia model, where:

These data collectively establish RNF152 as an important positive regulator of inflammatory responses that operates specifically through MyD88-dependent TLR and IL-1R signaling pathways.

How does RNF152 enhance MyD88-dependent signaling independent of its E3 ligase activity?

RNF152's regulation of MyD88-dependent signaling represents a fascinating case of functional diversity independent of its canonical E3 ligase activity. Detailed mechanistic studies have revealed that RNF152 enhances MyD88-dependent signaling through direct facilitation of MyD88 oligomerization, a critical step in signal transduction .

When investigating the molecular requirements for this function, researchers generated E3-deficient point mutations (RNF152-C30S) and RING domain truncations (RNF152-ΔR). These modified constructs exhibited dramatically reduced autoubiquitination, confirming the loss of E3 ligase activity. Surprisingly, despite this enzymatic deficiency, both mutants retained their ability to potentiate IL-1β-stimulated NF-κB activation, providing clear evidence that the enzymatic activity is dispensable for this particular function .

Further mechanistic investigations revealed:

  • RNF152 directly interacts with the death domain of MyD88 through its C-terminal region

  • This interaction promotes MyD88 self-association, an essential step for Myddosome assembly

  • While the transmembrane domain is not required for direct binding to MyD88 in vitro, membrane association is necessary for RNF152 to facilitate MyD88 oligomerization in cells

  • Both E3-deficient mutants (RNF152-C30S and RNF152-ΔR) enhanced MyD88 dimerization or oligomerization similarly to wild-type RNF152

These findings illustrate a non-canonical, scaffold-like function of RNF152 in immune signaling that operates through protein-protein interactions rather than ubiquitin transfer, highlighting the multifunctional nature of this E3 ligase.

What are the contradictory findings regarding RNF152's role in different signaling pathways?

Research on RNF152 has revealed seemingly contradictory functional roles across different signaling pathways, demonstrating its context-dependent activity as both a positive and negative regulator. These paradoxical functions appear to operate through distinct molecular mechanisms:

As a Positive Regulator:

  • In TLR/IL-1R signaling, RNF152 enhances pathway activation by promoting MyD88 oligomerization

  • This function operates independently of its E3 ligase activity

  • Knockdown or knockout of RNF152 impairs inflammatory cytokine production

As a Negative Regulator:

  • In Wnt/β-catenin signaling, RNF152 suppresses pathway activation by interfering with Dishevelled (Dsh) polymerization

  • In mTORC1 signaling, RNF152 negatively regulates pathway activity through K63-linked polyubiquitination of RagA

  • These inhibitory functions appear to rely partially on its E3 ligase activity, with the catalytically inactive RNF152(CS) mutant exhibiting enhanced inhibitory effects on Wnt signaling due to increased protein stability

The mechanistic basis for these opposing effects appears related to:

  • Differential requirements for E3 ligase activity: catalytic activity is dispensable for TLR/IL-1R regulation but influences the kinetics of Wnt/β-catenin signaling through autoubiquitination-mediated self-regulation

  • Different protein interaction partners: promotes oligomerization of MyD88 while disrupting polymerization of Dsh

  • Distinct subcellular localization requirements: membrane association is crucial for MyD88 oligomerization enhancement in cells

These findings highlight the remarkable versatility of RNF152 as a signaling regulator whose function varies dramatically depending on cellular context and pathway engagement.

How does subcellular localization influence RNF152 function?

The subcellular localization of RNF152, primarily determined by its transmembrane domain, plays a critical role in dictating its functional capabilities across different signaling pathways. Research has revealed that membrane association is essential for some but not all of RNF152's regulatory activities.

In TLR/IL-1R Signaling:
Experimental evidence demonstrates that while the RNF152-ΔTM mutant (lacking the transmembrane domain) can directly bind to MyD88 in vitro, it loses the ability to enhance MyD88 self-association in cellular contexts. This indicates that proper membrane localization is required for RNF152 to effectively facilitate MyD88 oligomerization, which is necessary for downstream signaling events .

In Wnt/β-catenin Signaling:
The RNF152(dTM) mutant lacking the transmembrane domain exhibits a striking phenotype shift, losing its suppressive effect on Wnt/β-catenin signaling and instead functioning in a dominant-negative manner. In Xenopus embryo studies, this resulted in expanded expression of neural crest markers, contrasting with the suppressive effects observed with wild-type RNF152 .

These findings collectively demonstrate that the transmembrane domain-mediated localization of RNF152 is not merely a passive targeting mechanism but an active determinant of its functional capabilities, allowing it to properly position within specific membrane microdomains to interact with and regulate its various protein partners.

What are the optimal methods for expressing and purifying recombinant RNF152?

Recombinant RNF152 can be produced using several expression systems, each with specific advantages depending on research requirements. Based on available commercial and research approaches, the following methods have been validated for RNF152 expression and purification:

Expression Systems for RNF152:

Expression SystemAdvantagesConsiderationsApplications
E. coliHigh yield, cost-effective, rapid productionMay lack post-translational modifications, potential for inclusion bodiesStructural studies, in vitro enzymatic assays
YeastEukaryotic PTMs, higher solubilityLonger production time than E. coliFunctional studies requiring some PTMs
BaculovirusNear-native PTMs, good for membrane proteinsComplex setup, moderate yieldDetailed functional studies, protein-protein interactions
Mammalian cellFull complement of human PTMs, native foldingLower yield, higher cost, time-consumingSignaling studies, complex interaction analyses
In Vivo Biotinylation (E. coli)Site-specific biotinylation for detection/immobilizationRequires specialized vectorsPull-down assays, protein interaction studies

Each of these expression systems is commercially available for producing recombinant human RNF152 as demonstrated by the multiple product offerings from suppliers .

Purification Considerations:

  • Full-length RNF152 contains a transmembrane domain that complicates purification; using detergents like DDM or CHAPS is essential for extracting membrane-associated protein

  • Catalytically active RING domain can promote autoubiquitination during expression, potentially reducing yield; consider using proteasome inhibitors

  • For functional studies requiring the RING domain without membrane association challenges, expressing the RING domain alone (RNF152-ΔTM) provides higher yield and simplifies purification

Quality Control:
Verification of proper folding and activity can be performed using:

  • Autoubiquitination assays to confirm E3 ligase activity

  • Circular dichroism to assess secondary structure

  • Thermal shift assays to evaluate protein stability

  • Western blotting with domain-specific antibodies to confirm expression of intact protein

What experimental approaches can assess RNF152's effect on MyD88 oligomerization?

Investigating RNF152's impact on MyD88 oligomerization requires multiple complementary experimental approaches to fully characterize this non-enzymatic function. Based on published research methodologies, the following approaches have proven effective:

Cellular Co-immunoprecipitation Assays:

  • Co-transfect cells with differentially tagged MyD88 constructs (e.g., Flag-MyD88 and HA-MyD88)

  • Express wild-type or mutant RNF152 constructs (WT, C30S, ΔR, ΔTM) in these cells

  • Immunoprecipitate with anti-Flag antibody and detect co-precipitated HA-MyD88

  • This approach successfully demonstrated that wild-type RNF152, RNF152-C30S, and RNF152-ΔR enhanced MyD88 dimerization, while RNF152-ΔTM did not

In Vitro Binding Assays:

  • Express and purify GST-tagged RNF152 variants and His-tagged MyD88

  • Perform GST pull-down assays to detect direct binding

  • Assess MyD88 self-association by mixing differentially tagged MyD88 constructs with or without RNF152

  • This method confirmed that GST-RNF152-ΔTM could bind MyD88 and promote its self-association in vitro, despite failing to enhance oligomerization in cells

Functional Reporter Assays:

  • Transfect cells with an NF-κB luciferase reporter construct

  • Co-express RNF152 variants with or without stimulation by IL-1β

  • Measure luciferase activity to assess functional impact on downstream signaling

  • This approach established that RNF152 enhances IL-1β-induced NF-κB activation, with knockdown showing the opposite effect

Microscopy-Based Approaches:
While not specifically described for MyD88, similar techniques used for visualizing Dishevelled distribution could be adapted:

  • Express fluorescently tagged MyD88 in cells with or without RNF152

  • Monitor distribution pattern via confocal microscopy

  • Analyze changes in punctate versus diffuse distribution patterns

The combination of these complementary approaches provides robust evidence for RNF152's role in promoting MyD88 oligomerization, while also distinguishing between direct binding capability and functional enhancement of oligomerization in cellular contexts.

How can researchers effectively design experiments to study RNF152's dual roles in different signaling pathways?

Studying RNF152's divergent regulatory roles across different signaling pathways requires careful experimental design that can distinguish between its various functional mechanisms. Here are strategic approaches for investigating these dual roles:

Domain-Specific Mutant Analysis:

Create and utilize a panel of RNF152 variants to dissect domain-specific functions:

  • Catalytic Mutants: RNF152-C30S (point mutation in RING domain)

  • Domain Deletion Mutants: RNF152-ΔR (RING domain deletion), RNF152-ΔTM (transmembrane domain deletion)

  • Combined Mutants: Create double mutants to assess potential interdependence of domains

These mutants should be validated for:

  • Expression levels (Western blot)

  • Subcellular localization (immunofluorescence)

  • Autoubiquitination activity (ubiquitination assays)

Pathway-Specific Functional Assays:

Signaling PathwayExperimental ReadoutsKey Controls
TLR/IL-1RNF-κB reporter assay, inflammatory cytokine expression (qPCR), MyD88 oligomerization (co-IP)MyD88 knockout, TLR/IL-1R antagonists
Wnt/β-cateninTopFlash reporter assay, Dishevelled distribution, β-catenin stabilizationWnt pathway activators (Wnt3a, LiCl), β-catenin stabilized mutants
mTORC1S6K phosphorylation, 4E-BP1 phosphorylation, RagA ubiquitinationAmino acid starvation/stimulation, rapamycin treatment
Neuronal DevelopmentNeuroD expression, Delta-Notch reporter assaysNotch pathway inhibitors, developmental model systems

Comparative Analysis Strategies:

  • Parallel Pathway Assessment: Simultaneously examine effects of the same RNF152 construct on multiple pathways in the same cellular system to control for expression differences

  • Dose-Response Relationships: Establish whether pathways differ in sensitivity to RNF152 levels by creating stable cell lines with inducible expression

  • Temporal Dynamics: Use time-course experiments to determine if RNF152's effects on different pathways follow distinct kinetics

  • Interactome Analysis: Perform immunoprecipitation followed by mass spectrometry to identify pathway-specific interaction partners under different conditions

In Vivo Validation Approaches:

  • Conditional Knockout Models: Generate tissue-specific RNF152 knockout mice to assess pathway-specific phenotypes

  • Rescue Experiments: In RNF152-deficient models, introduce wild-type or mutant RNF152 constructs to determine which domains are sufficient for rescuing specific pathway defects

  • Physiological Challenge Models: Subject RNF152-deficient animals to pathway-specific stimuli (e.g., LPS for inflammatory response, developmental challenges for Wnt-dependent processes)

By systematically applying these experimental approaches, researchers can effectively dissect the mechanisms underlying RNF152's seemingly contradictory roles across different signaling networks.

What is the role of RNF152 in inflammation and immune responses?

RNF152 functions as a critical positive regulator of inflammatory responses through its enhancement of MyD88-dependent TLR and IL-1R signaling pathways. Its role in inflammation has been thoroughly characterized through both in vitro and in vivo experimental approaches.

Molecular Mechanisms in Inflammation:

RNF152 specifically enhances MyD88-dependent signaling pathways by promoting MyD88 oligomerization, a crucial step in the formation of the Myddosome signaling complex. This function operates independently of RNF152's E3 ligase activity, as evidenced by experiments with catalytically inactive mutants that retain the ability to enhance inflammatory signaling .

The evidence supporting RNF152's pro-inflammatory role includes:

These findings establish RNF152 as a potential therapeutic target in inflammatory conditions characterized by excessive MyD88-dependent signaling, such as sepsis, inflammatory bowel disease, and certain autoimmune disorders. The unique aspect of RNF152's function being independent of its enzymatic activity suggests that targeting protein-protein interactions rather than E3 ligase activity might be a more effective therapeutic strategy for modulating this inflammatory regulator.

How does RNF152 contribute to neuronal development processes?

RNF152 plays essential roles in neuronal development through its regulatory effects on multiple signaling pathways that control neurogenesis. Research in zebrafish models has provided compelling evidence for RNF152's contribution to neural development processes through both direct and indirect mechanisms.

Neuronal Development Functions:

RNF152 has been established as an important factor in neuronal development, with demonstrated roles in:

  • NeuroD Expression Regulation: Studies in zebrafish models have shown that RNF152 is essential for the expression of NeuroD, a critical transcription factor that drives neuronal differentiation and maturation

  • Delta-Notch Signaling Modulation: RNF152 appears to influence the Delta-Notch signaling pathway, which is crucial for controlling the balance between neural progenitor maintenance and differentiation during neurogenesis

  • mTORC1 Signaling in Neural Development: As a regulator of mTORC1 activity, RNF152 may provide a mechanistic link between nutrient sensing and neurogenesis. mTOR signaling is known to be critical in neonatal neuronal stem cells in the subventricular zone during neurogenesis, and RNF152's negative regulation of this pathway could help fine-tune the balance between proliferation and differentiation

The importance of RNF152 in neuronal development is further supported by its conserved expression patterns across species and its regulatory connections to multiple pathways known to be essential for proper neural development:

  • Wnt/β-catenin Pathway: RNF152's negative regulation of Wnt/β-catenin signaling in Xenopus embryonic development, particularly its effects on neural crest formation, suggests a broader role in patterning neural tissues during development

  • Disruption of Dishevelled Polymerization: By interfering with Dsh polymerization and signalosome formation, RNF152 may help regulate the spatiotemporal dynamics of Wnt signaling during critical periods of neural development

These findings collectively point to RNF152 as a multifaceted regulator of neuronal development, likely functioning at the intersection of multiple signaling networks that coordinate the complex processes of neurogenesis, neural patterning, and differentiation. Future research exploring RNF152's role in mammalian brain development could provide valuable insights into neurodevelopmental disorders and potential therapeutic approaches.

What emerging technologies could advance our understanding of RNF152?

Several cutting-edge technologies show particular promise for elucidating the complex functions and regulatory networks of RNF152:

CRISPR-Based Technologies:

  • CRISPRi/CRISPRa Systems: For precise temporal control of RNF152 expression to study dose-dependent effects across multiple pathways simultaneously

  • CRISPR Base Editing: To introduce specific point mutations in endogenous RNF152 (e.g., C30S) without disrupting gene architecture

  • CRISPR Screening: To identify synthetic lethal interactions and novel pathway connections in different cellular contexts

Advanced Protein Interaction Analysis:

  • Proximity Labeling Techniques (BioID, TurboID): To map the dynamic RNF152 interactome under different signaling conditions and in distinct subcellular compartments

  • Single-Molecule Pull-Down (SiMPull): To visualize and quantify RNF152's effects on protein complex formation (e.g., MyD88 oligomerization) at the single-molecule level

  • Förster Resonance Energy Transfer (FRET): To monitor real-time protein-protein interactions and conformational changes in living cells

Structural Biology Approaches:

  • Cryo-Electron Microscopy: To resolve the structure of RNF152 in complex with its binding partners (MyD88, Dishevelled, RagA)

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To map binding interfaces and conformational changes upon protein interaction

  • AlphaFold2-Assisted Modeling: To predict and validate structural features of RNF152 domains and their interaction interfaces

Systems Biology Integration:

  • Multi-omics Profiling: Integrating transcriptomics, proteomics, and ubiquitinomics data from RNF152-perturbed systems

  • Single-Cell Analysis: To understand cell-type specific roles of RNF152 in heterogeneous tissues like brain or immune cells

  • Computational Network Modeling: To predict and validate RNF152's differential effects across signaling pathways

Translational Research Tools:

  • Patient-Derived iPSCs: To study RNF152 function in human neuronal development and disease-relevant contexts

  • Tissue-Specific Conditional Knockout Models: For dissecting RNF152's tissue-specific roles in development and disease

  • Small Molecule Screening: To identify compounds that specifically modulate RNF152's scaffold function without affecting its E3 ligase activity

Implementation of these emerging technologies would significantly advance our understanding of RNF152's multifaceted roles in cellular signaling and potentially reveal new therapeutic opportunities for targeting its functions in disease contexts.

What are the most promising therapeutic applications targeting RNF152?

Based on current understanding of RNF152's functions, several therapeutic applications show particular promise for future development:

Anti-Inflammatory Interventions:
Given RNF152's role as a positive regulator of MyD88-dependent inflammatory signaling, inhibiting its function could offer therapeutic benefits in conditions characterized by excessive inflammation:

  • Sepsis and Endotoxemia: RNF152-deficient mice demonstrated improved survival in LPS-induced endotoxemia models, suggesting that targeting RNF152 could mitigate cytokine storm conditions

  • Chronic Inflammatory Diseases: Conditions with dysregulated TLR/IL-1R signaling, such as inflammatory bowel disease or rheumatoid arthritis, might benefit from RNF152 inhibition

  • Selective Pathway Modulation: Since RNF152 affects MyD88-dependent but not TRIF-dependent pathways, targeting it could allow more selective immunomodulation compared to broader TLR inhibitors

Neurodevelopmental Disorder Therapies:
RNF152's involvement in neuronal development through NeuroD expression and Delta-Notch signaling suggests potential applications in neurodevelopmental conditions:

  • Neurodevelopmental Disorders: Modulation of RNF152 activity could potentially correct aberrant neuronal differentiation patterns in certain developmental disorders

  • Neurodegenerative Disease: Given connections to mTORC1 signaling, RNF152 modulators might influence neuronal survival or regeneration pathways

Cancer Therapeutics:
RNF152's regulatory roles in multiple pathways relevant to cancer biology suggest potential oncology applications:

  • Wnt-Dependent Cancers: Enhancing RNF152's negative regulation of Wnt/β-catenin signaling could suppress this pathway in cancers where it drives tumor growth

  • mTORC1-Driven Tumors: As a negative regulator of mTORC1 signaling, RNF152 enhancement might complement existing mTOR inhibitors in certain cancer types

Therapeutic Targeting Approaches:

Rather than traditional enzyme inhibition approaches, the unique features of RNF152 suggest alternative therapeutic strategies:

  • Protein-Protein Interaction Modulators: Small molecules or peptide mimetics that disrupt RNF152's interaction with MyD88 could specifically inhibit its pro-inflammatory function

  • Stability Modulators: Compounds that enhance RNF152 degradation could reduce its activity in inflammatory conditions, while stabilizers might enhance its tumor-suppressive functions

  • Localization Modifiers: Since membrane localization is crucial for some but not all RNF152 functions, compounds that alter its subcellular distribution could selectively modulate specific activities

These potential therapeutic applications represent promising directions for translational research on RNF152, with particular emphasis on inflammatory conditions where proof-of-concept studies in knockout models have already demonstrated significant phenotypic effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.