Recombinant Human E3 ubiquitin-protein ligase RNF5 (RNF5)

Shipped with Ice Packs
In Stock

Description

Ubiquitination of Viral Proteins

RNF5 directly targets viral structural proteins to restrict or facilitate infection:

SubstrateUbiquitination TypeBiological EffectSource Virus
SARS-CoV-2 E proteinK48-linkedProteasomal degradation, inhibits viral replication SARS-CoV-2
SARS-CoV-2 M proteinK63-linkedStabilizes M-E complex; promotes virion release SARS-CoV-2
HSV-1 VP16K48-linkedSuppresses interferon response Herpes simplex virus 1

Host Immune Regulation

RNF5 negatively regulates antiviral signaling by degrading:

  • STING: K48-linked ubiquitination leads to proteasomal degradation, suppressing DNA virus responses .

  • MAVS: Ubiquitination disrupts mitochondrial antiviral signaling, limiting RNA virus defense .

Antiviral Strategies

  • Analog-1: A pharmacological activator of RNF5 reduces SARS-CoV-2 replication by enhancing E protein degradation (EC₅₀ = 2.1 μM in vitro; 75% viral load reduction in mice) .

  • siRNA knockdown: Silencing RNF5 in breast cancer cells increases sensitivity to paclitaxel by 40% .

Biomarker Potential

  • COVID-19 Prognosis: Higher RNF5 mRNA levels correlate with milder disease (3.2-fold increase in mild vs. severe cases) .

  • Cancer Prognosis: Overexpression in breast cancer tumors associates with poor survival (HR = 1.8, p < 0.01) .

Key Studies on Recombinant RNF5

Study FocusMethodologyKey ResultReference
SARS-CoV-2 E degradationUbiquitination assaysRNF5 catalyzes E degradation via K63 ubiquitination, reducing viral titers by 90%
M protein interactionCo-IP + VLP assaysK15R mutation in M abolishes RNF5-mediated virion release (p < 0.001)
STING regulationImmunoblottingRNF5 knockout increases STING levels by 4-fold, enhancing IFN-β production

Challenges and Future Directions

  • Therapeutic Targeting: RNF5 agonists (e.g., Analog-1) face challenges due to its dual role in promoting viral assembly (via M) and suppressing replication (via E) .

  • Tissue-Specific Effects: RNF5 expression varies by age and cell type, necessitating targeted delivery systems for clinical use .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based solution containing 5%-50% glycerol. For lyophilized powder, the buffer used prior to lyophilization is a Tris/PBS-based buffer with 6% Trehalose.
Description

This recombinant Human RNF5 protein is an in vitro expressed protein, produced using a cell-free E.coli expression system (Full Length of Mature Protein). Its purity is 85%+ as determined by SDS-PAGE. Cell-free protein expression refers to the in vitro synthesis of a protein using translation-compatible extracts of whole cells. These extracts essentially contain all the necessary macromolecules and components for transcription, translation, and even post-translational modification. This includes RNA polymerase, regulatory protein factors, transcription factors, ribosomes, and tRNA. When supplemented with cofactors, nucleotides, and the specific gene template, these extracts can synthesize proteins of interest within a few hours.

RNF5 is an endoplasmic reticulum (ER)-related E3 ubiquitin ligase that forms the UBC6e-p97 complex, which plays a crucial role in ER-associated degradation (ERAD). RNF5 can recognize misfolded proteins and facilitate their ubiquitination and subsequent degradation by the proteasome. It is implicated in the inflammatory response during viral infections through the ubiquitination of transmembrane protein 173, and it also suppresses the activation of virus-induced interferon regulatory factor 3, expression of interferon beta 1, and the cellular antiviral response. RNF5 is upregulated in various cancers, including breast cancer, hepatocellular carcinoma, and acute myeloid leukemia (AML). Inhibition of RNF5 expression has been shown to reduce proliferation of breast cancer cells.
Form
Liquid or Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them when placing your order, and we will prepare according to your needs.
Lead Time
18-23 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
RNF5; G16; NG2; RMA1; E3 ubiquitin-protein ligase RNF5; Protein G16; RING finger protein 5; RING-type E3 ubiquitin transferase RNF5; Ram1 homolog; HsRma1
Datasheet & Coa
Please contact us to get it.
Expression Region
2-180aa
Mol. Weight
25.8 kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Transferase
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
RNF5 exhibits E2-dependent E3 ubiquitin-protein ligase activity. It may function in conjunction with E2 ubiquitin-conjugating enzymes UBE2D1/UBCH5A and UBE2D2/UBC4. RNF5 mediates the ubiquitination of PXN/paxillin and Salmonella type III secreted protein sopA. It may be involved in regulating cell motility and the localization of PXN/paxillin. RNF5 mediates the 'Lys-63'-linked polyubiquitination of JKAMP, thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD. This ubiquitination process appears to involve E2 ubiquitin-conjugating enzyme UBE2N. RNF5 mediates the 'Lys-48'-linked polyubiquitination of STING1 at 'Lys-150', leading to its proteasomal degradation. This ubiquitination event occurs in mitochondria after viral transfection and regulates antiviral responses.
Gene References Into Functions
  1. Our research identified RNF5 as differentially expressed in human bronchial epithelia from CF patients compared to controls. This suggests that RNF5 could be a target for therapeutic interventions to antagonize mutant CFTR proteins. PMID: 26183966
  2. RNF5 is involved in the regulation of the L-glutamine carrier proteins SLC1A5 and SLC38A2. PMID: 25759021
  3. Our data indicate that RNF5 regulates the turnover of specific G protein-coupled receptors by ubiquitinating JAMP and preventing proteasome recruitment. PMID: 23798571
  4. In addition to confirming one of the top findings in the meta-analysis, TRIM26, RNF5 and HLA-DRB3 have been identified as potential candidate genes for schizophrenia. PMID: 22433715
  5. Rma1, an E3 ubiquitin ligase localized in the ER membrane, is involved in Pendrin degradation PMID: 22750442
  6. JB12 cooperates with cytosolic Hsc70 and the ubiquitin ligase RMA1 to target CFTR and CFTRDeltaF508 for degradation. PMID: 21148293
  7. found in cerebral microvessels endothelium PMID: 11603805
  8. RNF5 regulates cell motility by targeting paxillin ubiquitination and altered localization PMID: 12861019
  9. the G(16)-mediated activation of IKK/NFkappaB by N(6)-cyclohexyladenosine requires a complex signaling network composed of multiple intermediates PMID: 15485865
  10. efficient bacterial escape into the cytosol of epithelial cells requires HsRMA1-mediated SopA ubiquitination and contributes to Salmonella-induced enteropathogenicity PMID: 16176924
  11. RNF5 is a novel regulator of breast cancer progression through its effect on actin cytoskeletal alterations. PMID: 17804730
  12. RNF5 associates with JAMP in the ER membrane. This association results in Ubc13-dependent RNF5-mediated noncanonical ubiquitination of JAMP. PMID: 19269966
  13. E3 ubiquitin ligase RNF5 interacted with MITA in a viral-infection-dependent manner PMID: 19285439

Show More

Hide All

Database Links

HGNC: 10068

OMIM: 602677

KEGG: hsa:6048

STRING: 9606.ENSP00000364235

UniGene: Hs.731774

Subcellular Location
Membrane; Multi-pass membrane protein. Mitochondrion membrane. Endoplasmic reticulum membrane. Note=Predominantly located in the plasma membrane, with some localization occurring within cytoplasmic organelles.
Tissue Specificity
Widely expressed.

Q&A

What is the primary cellular function of RNF5?

RNF5 is an endoplasmic reticulum (ER) and/or mitochondrion-anchored E3 ubiquitin ligase that mediates ubiquitination of target proteins, tagging them for degradation. It contains a single transmembrane domain within its C-terminal region that anchors it to the ER membrane. RNF5 is implicated in ER-associated protein degradation (ERAD), cell motility regulation, and negative regulation of autophagy and ER stress . Its primary function involves recognizing misfolded or damaged proteins and facilitating their degradation through the ubiquitin-proteasome pathway, thereby maintaining cellular protein homeostasis .

How does RNF5 regulate the antiviral immune response?

RNF5 serves as a negative regulator of virus-triggered signaling pathways by targeting key components of the innate immune response. Specifically, RNF5 targets the stimulator of interferon genes (STING) and mitochondrial antiviral signaling protein (MAVS) for ubiquitination and subsequent degradation . During viral infections, such as herpes simplex virus-1 (HSV-1), RNF5 expression becomes elevated in infected tissues, as demonstrated in corneal tissues and corneal epithelial cells . This upregulation leads to K48-linked polyubiquitination of STING, resulting in its degradation and consequent inhibition of type I interferon responses, which are crucial for antiviral immunity . Additionally, viral proteins like the Newcastle disease virus V protein can recruit RNF5 to ubiquitinate MAVS, further suppressing antiviral responses .

What is the role of RNF5 in cardiac pathophysiology?

Research has revealed that RNF5 plays a protective role in pathological cardiac hypertrophy. Studies have shown that RNF5 expression increases in the hearts of mice with pathological cardiac hypertrophy . Through loss-of-function and gain-of-function experiments, researchers demonstrated that RNF5 deficiency exacerbates cardiac hypertrophy, while RNF5 overexpression attenuates it . The mechanism involves RNF5 interaction with the stimulator of interferon genes (STING), where RNF5 inhibits cardiac hypertrophy by promoting STING degradation through K48-linked polyubiquitination . This finding identifies RNF5 as an important regulatory factor in cardiac hypertrophy, suggesting potential therapeutic targets for heart failure prevention.

How does RNF5 expression correlate with patient prognosis in different cancer types?

RNF5 expression varies across cancer types and correlates differently with patient prognosis depending on the cancer:

Cancer TypeRNF5 Expression PatternCorrelation with PrognosisReference
Glioma (LGG)No significant correlationNo significant association with prognosis
Anaplastic glioma (AG)Higher than in GBMHigh expression correlates with improved prognosis
Glioblastoma (GBM)Lower than in LGG and AGHigh expression correlates with improved prognosis
Breast cancerVariableHigh expression correlates with shorter survival time
Neuroblastoma (NB)VariableHigh expression correlates with better prognosis
MelanomaVariableHigh expression correlates with better prognosis

What methodologies are used to analyze RNF5 expression in patient samples?

Researchers employ several complementary approaches to analyze RNF5 expression in patient samples:

For RT-qPCR specifically, researchers extract total RNA using TRIzol reagent, reverse-transcribe into cDNA, and perform qPCR using specific primers with appropriate internal controls (e.g., β-actin). Expression levels are typically calculated using the 2^-ΔΔCq method .

How can researchers effectively modulate RNF5 expression in experimental models?

Researchers can modulate RNF5 expression through several established methodologies:

  • Overexpression Systems:

    • Plasmid-based approaches: RNF5 cDNA can be inserted into expression vectors (e.g., p3XFLAG-CMV-14) between appropriate restriction sites (HindIII and XbaI)

    • Transfection: Plasmids can be transfected into cells using reagents such as Polyjet at a ratio of 1:3 (μg plasmid:μl reagent)

    • Viral delivery systems: Adenoviral or lentiviral vectors for efficient in vitro and in vivo gene delivery, particularly useful for challenging-to-transfect cell types

  • Knockdown/Knockout Approaches:

    • RNA interference (RNAi): siRNA or shRNA targeting RNF5 can effectively reduce expression levels

    • CRISPR-Cas9 gene editing: For complete knockout models in cell lines or animal models

    • Conditional knockout models: For tissue-specific or inducible RNF5 deletion in animal models

  • Pharmacological Modulation:

    • RNF5 activators: Compounds like Analog-1 have been shown to enhance RNF5 activity, reducing tumor cell proliferation and viability in neuroblastoma and melanoma models

    • Small molecule inhibitors: Can be designed to target RNF5's ubiquitin ligase activity

  • Verification Methods:

    • Western blotting, RT-qPCR, and immunofluorescence to confirm successful modulation of RNF5 expression levels

    • Functional assays to verify changes in ubiquitination activity and downstream effects

Experimental validation of modulation efficiency should include multiple techniques to confirm changes at both mRNA and protein levels, along with functional assays to assess the impact on known RNF5-mediated processes.

What approach should be used to identify RNF5 substrate proteins?

Identifying RNF5 substrate proteins requires a multi-faceted approach:

  • Differential Expression Analysis:

    • Group patient data according to RNF5 expression levels (from low to high)

    • Compare extreme groups (highest vs. lowest RNF5 expression) to identify differentially expressed genes (DEGs)

    • Apply statistical thresholds (e.g., |logFC|>1) to define significant DEGs

    • Identify overlapping DEGs across multiple datasets to increase confidence in results

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation (Co-IP) to capture RNF5-interacting proteins

    • Proximity-dependent biotin identification (BioID) or proximity ligation assay (PLA)

    • Yeast two-hybrid screening to identify direct binding partners

    • Mass spectrometry analysis of immunoprecipitated complexes

  • Ubiquitination Assays:

    • In vitro ubiquitination assays with recombinant RNF5 and candidate substrates

    • Immunoprecipitation followed by ubiquitin-specific western blotting

    • Analysis of proteasome inhibition effects on candidate substrate levels

    • K48-linked vs. K63-linked polyubiquitin chain analysis to determine degradation vs. signaling outcomes

  • Validation Studies:

    • Correlation analysis between RNF5 and candidate substrate expression levels

    • Overexpression and knockdown studies to confirm the regulatory relationship

    • Site-directed mutagenesis of ubiquitination sites on candidate substrates

    • Functional assays to determine biological significance of the ubiquitination

For example, researchers identified STING as an RNF5 substrate through protein-protein interaction experiments and demonstrated that RNF5 promotes STING degradation through K48-linked polyubiquitination, contributing to cardiac hypertrophy regulation .

What bioinformatic approaches can be employed for RNF5 pathway analysis?

Comprehensive bioinformatic analysis of RNF5 pathways involves several sophisticated approaches:

  • Gene Set Enrichment Analysis (GSEA):

    • Patient data can be analyzed using GSEA software (version 6.2) to identify enriched KEGG pathways associated with RNF5 expression

    • Significant enrichment is typically defined by a normalized enrichment score >1, nominal P<0.05, and false discovery rate q-value <0.25

    • This approach can reveal biological processes and signaling pathways potentially regulated by RNF5

  • Differential Expression Analysis:

    • Sorting datasets according to RNF5 expression levels from low to high

    • Dividing data into quantiles and comparing extreme groups (highest vs. lowest RNF5 expression)

    • Using R software with packages like limma to identify differentially expressed genes

    • Implementing stringent criteria (|logFC|>1) to define significant differential expression

  • Network Analysis:

    • Construction of protein-protein interaction networks using databases like STRING, BioGRID, or IntAct

    • Visualization of networks using tools like Cytoscape

    • Identification of hub proteins and key signaling nodes connected to RNF5

    • Module detection algorithms to identify functional protein clusters

  • Correlation Analysis:

    • Pearson's correlation coefficient tests to assess relationships between RNF5 and candidate genes

    • Visualization of correlations using heatmaps and scatter plots

    • Identification of positively and negatively correlated gene sets

  • Multi-omics Integration:

    • Integration of transcriptomic, proteomic, and ubiquitinome data

    • Pathway enrichment analysis across multiple data types

    • Identification of convergent patterns indicating RNF5-regulated processes

These approaches have successfully identified pathways regulated by RNF5, including its role in STING degradation affecting antiviral responses and cardiac hypertrophy .

How does RNF5 affect cellular metabolism in cancer models?

RNF5 exhibits significant effects on cellular metabolism in cancer models, particularly in neuroectodermal tumors like neuroblastoma and melanoma:

  • Amino Acid Metabolism:

    • RNF5 activation via compounds like Analog-1 reduces intracellular glutamine and glutamate levels in neuroblastoma and melanoma cells

    • This alteration in amino acid metabolism can impair tumor cell growth, as many cancer cells are glutamine-dependent

  • Energy Metabolism:

    • RNF5 activation impairs energetic metabolism through inhibition of key metabolic processes

    • This metabolic disruption contributes to reduced tumor cell proliferation and viability

  • Metabolic Reprogramming:

    • The metabolic alterations induced by RNF5 activation may contribute to its tumor-suppressive effects in certain contexts

    • High RNF5 expression correlates with better prognosis in neuroblastoma and melanoma patients, possibly through these metabolic effects

These findings suggest that RNF5 may serve as a metabolic regulator in cancer cells, with context-dependent effects across different tumor types. Therapeutic approaches targeting RNF5 to modulate cancer cell metabolism represent a promising research direction.

What is the role of RNF5 in viral infection and immune response?

RNF5 serves as a critical regulator of antiviral immunity through multiple mechanisms:

  • Negative Regulation of Interferon Signaling:

    • RNF5 targets STING for ubiquitination and degradation through K48-linked polyubiquitination

    • STING is a crucial adaptor protein that activates type I interferon responses upon viral infection

    • By degrading STING, RNF5 can inhibit type I interferon production, potentially dampening antiviral immunity

  • Mitochondrial Antiviral Signaling Regulation:

    • RNF5 targets MAVS (mitochondrial antiviral signaling protein) for ubiquitination and degradation

    • MAVS is essential for RIG-I-like receptor-mediated antiviral responses

    • Some viruses exploit this regulatory mechanism, as demonstrated by Newcastle disease virus V protein, which recruits RNF5 to polyubiquitinate MAVS

  • Virus-Induced Expression Changes:

    • Viral infections can modulate RNF5 expression patterns

    • In herpes simplex virus-1 (HSV-1) infection, RNF5 expression is significantly elevated in infected corneal tissues and corneal epithelial cells

    • This elevation may represent a viral immune evasion strategy or a host response mechanism

  • SARS-CoV-2 Viral Assembly Regulation:

    • RNF5 facilitates SARS-CoV-2 membrane protein (M) ubiquitination

    • This modification enhances the interaction of M with envelope protein (E), promoting virion release

    • RNF5-mediated ubiquitination also affects M targeting to autophagosomes

These findings highlight the complex role of RNF5 in viral infection and immunity, functioning both as a host regulatory mechanism and as a potential target for viral immune evasion strategies. The dual role makes RNF5 an interesting target for antiviral therapeutic development.

How does RNF5 influence cell proliferation and viability in experimental models?

RNF5 exerts context-dependent effects on cell proliferation and viability across different experimental models:

  • Cancer Cell Models:

    • In glioblastoma cell line U251, RNF5 overexpression can be studied using plasmid transfection (p3XFLAG-CMV-14 vector) and cell colony formation assays

    • Cells overexpressing RNF5 show altered colony formation patterns after 14 days of culture, indicating effects on cell proliferation

    • In neuroblastoma and melanoma models, activation of RNF5 using the compound Analog-1 reduces tumor cell proliferation and viability

  • Cardiac Models:

    • RNF5 deficiency exacerbates cardiac hypertrophy in mouse models

    • Conversely, RNF5 overexpression attenuates cardiac hypertrophy

    • These effects operate through RNF5-mediated regulation of STING degradation via K48-linked polyubiquitination

  • Experimental Approaches for Assessment:

    • Cell viability assays (MTT, CCK-8, trypan blue exclusion)

    • Cell proliferation assays (BrdU incorporation, Ki-67 staining)

    • Colony formation assays (as described in the U251 glioblastoma cell studies)

    • Cell cycle analysis by flow cytometry

    • In vivo tumor growth assays in mouse models

  • Signaling Pathway Analysis:

    • GSEA can be employed to identify signaling pathways enriched in relation to RNF5 expression

    • Pathway analysis helps elucidate the mechanisms through which RNF5 affects cell proliferation and viability

The divergent effects of RNF5 on cell proliferation and viability across different disease models highlight its context-dependent roles, which may explain its varying prognostic implications in different cancer types.

How can RNF5 be targeted therapeutically in disease models?

Therapeutic targeting of RNF5 shows promise across several disease contexts, with multiple strategies available:

  • Pharmacological Modulators:

    • RNF5 activators: Compounds like Analog-1 have shown therapeutic potential in neuroblastoma and melanoma models by reducing tumor cell proliferation and viability, decreasing glutamine and glutamate levels, and impairing energy metabolism

    • Development of small molecule inhibitors targeting RNF5's E3 ligase activity could be beneficial in contexts where RNF5 activity promotes disease progression

  • Disease-Specific Applications:

    • Cancer therapy: In neuroblastoma and melanoma, where high RNF5 expression correlates with better prognosis, RNF5 activators show promise as therapeutic agents

    • Cardiac protection: Since RNF5 attenuates pathological cardiac hypertrophy, enhancing its expression or activity might protect against heart failure progression

    • Antiviral strategies: Modulating RNF5 activity could enhance antiviral responses by preventing STING and MAVS degradation, potentially beneficial in viral infections including HSV-1 and SARS-CoV-2

  • Delivery Approaches:

    • Targeted nanoparticles for tissue-specific delivery

    • Gene therapy vectors for localized expression modulation

    • Cell-penetrating peptides conjugated to RNF5 modulators

  • Combination Therapies:

    • Combining RNF5 modulators with standard-of-care treatments

    • Pairing with immune checkpoint inhibitors in cancer contexts

    • Co-targeting metabolic pathways affected by RNF5 modulation

Research indicates that targeting RNF5 represents a potentially novel therapeutic approach across multiple disease contexts, though optimal strategies will need to be tailored to the specific disease and desired outcome.

What are the contradictory findings regarding RNF5 in different disease contexts?

Research on RNF5 has revealed several apparent contradictions across disease contexts that warrant careful consideration:

These contradictions highlight the complex, context-dependent nature of RNF5 function and underscore the importance of comprehensive, multi-modal analyses when studying its role in disease pathogenesis and potential therapeutic applications.

What are the emerging techniques for studying RNF5 protein-protein interactions and ubiquitination targets?

Advanced methodologies are revolutionizing our understanding of RNF5 interactions and ubiquitination targets:

  • Proximity-Based Proteomics:

    • BioID and TurboID: Fusion of RNF5 with biotin ligases to identify proximal proteins in living cells

    • APEX2 proximity labeling: Allows temporal control and subcellular resolution of RNF5 interactions

    • These approaches capture both stable and transient interactions, including those occurring in specific subcellular compartments like the ER membrane

  • Ubiquitinome Analysis:

    • Ubiquitin remnant profiling using K-ε-GG antibodies coupled with mass spectrometry

    • SILAC or TMT labeling to quantitatively compare ubiquitination patterns in RNF5 overexpression or knockout models

    • Targeted analysis of K48-linked ubiquitination, which RNF5 is known to mediate on substrates like STING

  • Structural Biology Approaches:

    • Cryo-electron microscopy of RNF5-substrate complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • In silico molecular docking and dynamics simulations to predict binding modes and design inhibitors

  • Genetic Screening Methods:

    • CRISPR-Cas9 screens to identify genes that modulate RNF5 function

    • Synthetic lethal screens in RNF5-deficient or RNF5-overexpressing backgrounds

    • Genome-wide association studies correlating genetic variants in RNF5 or its pathway components with disease outcomes

  • Single-Cell Analysis:

    • Single-cell RNA-seq to capture heterogeneity in RNF5 expression and its correlates

    • Single-cell proteomics to examine RNF5 protein levels and modifications at the individual cell level

    • Spatial transcriptomics to examine RNF5 expression patterns within tissue architecture

These emerging techniques promise to provide unprecedented insights into RNF5 biology, potentially revealing new therapeutic targets and biomarkers across multiple disease contexts.

How can inconsistencies in RNF5 expression data across different cancer types be reconciled?

Reconciling inconsistent RNF5 expression data across cancer types requires systematic approaches:

  • Standardized Analysis Frameworks:

    • Implement consistent bioinformatic pipelines across datasets

    • Use identical normalization methods and quality control criteria

    • Apply uniform thresholds for defining "high" versus "low" expression

    • Employ meta-analysis approaches to integrate findings across studies

  • Molecular Subtyping Integration:

    • Stratify analyses by molecular subtypes within each cancer type

    • Consider the genetic background (mutations, copy number variations) that might influence RNF5 function

    • Integrate RNF5 expression with pathway activation signatures

  • Multi-omics Analysis:

    • Correlate RNF5 mRNA expression with protein levels to account for post-transcriptional regulation

    • Examine RNF5 protein modifications that might affect function

    • Assess RNF5 genomic alterations (mutations, amplifications, deletions) across cancer types

  • Cellular Context Considerations:

    • Analyze RNF5 expression in relation to tumor microenvironment composition

    • Account for cell-type specific functions of RNF5

    • Consider the impact of hypoxia, inflammation, and other tumor microenvironmental factors

  • Experimental Validation:

    • Perform isogenic cell line studies with controlled RNF5 expression across multiple cancer types

    • Develop tissue-specific conditional RNF5 knockout mouse models for in vivo validation

    • Use patient-derived xenografts to preserve tumor heterogeneity

By implementing these approaches, researchers can develop a more nuanced understanding of how RNF5 functions across different cancer contexts, potentially explaining the seemingly contradictory prognostic associations observed in different malignancies .

What are the optimal experimental conditions for assessing RNF5 activity in vitro?

Optimal experimental conditions for assessing RNF5 activity require careful consideration of multiple factors:

  • Recombinant Protein Preparation:

    • Expression systems: E. coli, insect cells, or mammalian cells, with mammalian systems preferred for proper folding and post-translational modifications

    • Purification tags: N-terminal or C-terminal, considering that C-terminal tags may interfere with RNF5's transmembrane domain

    • Storage conditions: Typically in buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5% glycerol, and 1 mM DTT at -80°C

  • In Vitro Ubiquitination Assay Components:

    • E1 (ubiquitin-activating enzyme): Typically UBE1 at 50-100 nM

    • E2 (ubiquitin-conjugating enzyme): Multiple E2s should be tested, including UBE2D1-4 and UBE2N, at 0.5-1 μM

    • Substrate: Purified candidate protein (e.g., STING, MAVS) at 0.5-1 μM

    • Ubiquitin: Wild-type or mutant ubiquitin (K48-only, K63-only) at 50-100 μM

    • Buffer: Typically 50 mM Tris-HCl (pH 7.5), 5 mM MgCl2, 2 mM ATP, 1 mM DTT

    • Incubation conditions: 30-37°C for 1-2 hours

  • Cell-Based Ubiquitination Assays:

    • Cell types: HEK293T for transfection efficiency, or disease-relevant cell lines (U251 for glioblastoma studies)

    • Transfection: Optimize plasmid:transfection reagent ratio (e.g., 1:3 for Polyjet)

    • Proteasome inhibitors: MG132 (10 μM) for 4-6 hours before cell lysis to prevent degradation of ubiquitinated proteins

    • Lysis conditions: Denaturing lysis (1% SDS with heating) followed by dilution for immunoprecipitation to disrupt non-covalent interactions

  • Detection Methods:

    • Western blotting: Using antibodies specific for ubiquitin or K48/K63 linkages

    • Mass spectrometry: For unbiased identification of ubiquitination sites

    • ELISA-based methods: For high-throughput screening of RNF5 activity modulators

  • Controls and Validation:

    • Catalytically inactive RNF5 mutant (typically mutation in the RING domain)

    • Omission of individual components (E1, E2, ATP) as negative controls

    • Known RNF5 substrates (STING, MAVS) as positive controls

These optimized conditions ensure reliable assessment of RNF5 activity and provide a foundation for screening potential modulators or identifying novel substrates.

What are the best practices for analyzing RNF5 expression in patient samples across different pathologies?

Best practices for analyzing RNF5 expression in patient samples require rigorous methodology:

  • Sample Collection and Preservation:

    • Flash-freezing tissues immediately after collection for RNA and protein preservation

    • Formalin-fixed paraffin-embedded (FFPE) samples for immunohistochemistry

    • Standardized collection protocols to minimize pre-analytical variables

    • Detailed clinical annotation including treatment history and outcome data

  • RNA Expression Analysis:

    • RT-qPCR with validated primers (e.g., RNF5 forward: 5′-GTACCCATACGATGTTCCAGATTACGC-3′, reverse: 5′-CTGAGCAGCCAGAAAAAGAAAAAGATG-3′)

    • Appropriate reference genes (e.g., β-actin) for normalization

    • RNA-seq with sufficient depth (>30 million reads) for accurate quantification

    • Consistent bioinformatic pipelines for data processing

  • Protein Expression Analysis:

    • Validated antibodies for Western blotting and immunohistochemistry

    • Appropriate positive and negative controls in each experiment

    • Quantitative scoring systems for immunohistochemistry

    • Digital pathology tools for objective quantification

  • Data Analysis Approaches:

    • Stratification by disease subtypes, stages, and molecular features

    • Appropriate statistical methods based on data distribution (parametric vs. non-parametric)

    • Survival analysis using Kaplan-Meier curves with log-rank tests

    • Multivariate analysis to account for confounding factors

  • Database Integration:

    • Utilization of multiple databases (CGGA, TCGA, GEO datasets)

    • Consistent cut-off determination (e.g., median expression value)

    • Cross-validation across independent cohorts

    • Integration with other molecular data (mutations, copy number)

  • Reporting Standards:

    • Transparent methodology description

    • Clear definition of thresholds used for categorization

    • Appropriate statistical metrics (p-values, hazard ratios with confidence intervals)

    • Consideration of multiple testing correction for exploratory analyses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.