Recombinant Human E3 ubiquitin-protein ligase synoviolin (SYVN1)

Shipped with Ice Packs
In Stock

Description

Protein Quality Control

SYVN1 is a central component of ERAD, targeting misfolded ER proteins for ubiquitination and degradation. It recognizes substrates such as:

  • Unfolded proteins during ER stress

  • Polyglutamine-expanded huntingtin (HTT) in neurodegenerative diseases

  • Pro-apoptotic factors like IRE1 and TP53

Key PathwayFunctionReferences
Ubiquitin-Mediated ProteolysisTags misfolded proteins for proteasomal degradation
ER Stress ResponseReduces ER stress by clearing accumulated proteins
Apoptosis RegulationDegrades pro-apoptotic IRE1, promoting cell survival in rheumatoid arthritis

Metabolic Regulation

SYVN1 regulates energy expenditure and adipogenesis by targeting peroxisome proliferator-activated receptor coactivator (PGC)-1β:

  • PGC-1β Ubiquitination: SYVN1 ubiquitinates PGC-1β, reducing mitochondrial biogenesis and energy expenditure .

  • Obesity Link: Syvn1-deficient mice exhibit resistance to obesity, increased mitochondrial activity, and higher basal metabolic rates .

Disease Associations

  • Rheumatoid Arthritis: Overexpression in synovial fibroblasts reduces ER stress-induced apoptosis, contributing to synovial hyperplasia .

  • Hepatocellular Carcinoma (HCC): SYVN1 promotes metastasis by interacting with HSP90 and regulating eukaryotic elongation factor 2 kinase (EEF2K) ubiquitination .

  • Neurodegeneration: Protects against apoptosis induced by misfolded GPR37 or HTT .

Therapeutic Targeting

  • SYVN1 Inhibitors: Compound LS-102 blocks SYVN1-mediated PGC-1β degradation, showing efficacy in reducing weight gain in murine obesity models .

  • Cancer Therapy: SYVN1 knockdown suppresses HCC metastasis by stabilizing EEF2K and altering ubiquitination profiles .

Table 1: SYVN1 Substrates and Functional Outcomes

SubstrateEffect of SYVN1 InteractionDisease RelevanceReferences
IRE1Ubiquitination and degradationRheumatoid arthritis
PGC-1βReduced mitochondrial biogenesisObesity
TP53Cytoplasmic sequestration and degradationCancer progression
EEF2KStabilization via reduced ubiquitinationHCC metastasis

Table 2: SYVN1 Knockout Phenotypes

ModelPhenotypeMechanismReferences
Syvn1<sup>-/-</sup> miceResistance to diet-induced obesityIncreased PGC-1β activity
Adipose-specific KOElevated mitochondrial respirationEnhanced thermogenesis
CIA synovial fibroblastsRestored ER stress-induced apoptosisIRE1 stabilization

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have any specific requirement for the format, please remark your requirement when placing the order. We will prepare the product according to your demand.
Lead Time
Delivery time may differ from different purchasing methods or locations. Please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are shipped with normal blue ice packs by default. If you require shipping with dry ice, please communicate with us in advance as additional fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize development of the specified tag.
Synonyms
SYVN1; HRD1; KIAA1810; E3 ubiquitin-protein ligase synoviolin; RING-type E3 ubiquitin transferase synoviolin; Synovial apoptosis inhibitor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-617
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
YYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKVMGKVFFGQLRAAEMEHLLERSW YAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLAEDRVDFMERSPNISWLFHCRIV SLMFLLGILDFLFVSHAYHSILTRGASVQLVFGFEYAILMTMVLTIFIKYVLHSVDLQSE NPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMIKVHTFPLFAIRPMYLAMRQFKKAVTDA IMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQR QQTCPTCRMDVLRASLPAQSPPPPEPADQGPPPAPHPPPLLPQPPNFPQGLLPPFPPGMF PLWPPMGPFPPVPPPPSSGEAVAPPSTSAAALSRPSGAATTTAAGTSATAASATASGPGS GSAPEAGPAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALEGHERQHLEA RLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIPSS EATTPTPGASPPAPEMERPPAPESVGTEEMPEDGEPDAAELRRRRLQKLESPVAH
Uniprot No.

Target Background

Function
Synoviolin (SYVN1) is an E3 ubiquitin-protein ligase that accepts ubiquitin specifically from endoplasmic reticulum-associated UBC7 E2 ligase and transfers it to substrates, promoting their degradation. It is a component of the endoplasmic reticulum quality control (ERQC) system, also called ER-associated degradation (ERAD), involved in ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. SYVN1 also promotes the degradation of normal but naturally short-lived proteins such as SGK. It protects cells from ER stress-induced apoptosis and neurons from apoptosis induced by polyglutamine-expanded huntingtin (HTT) or unfolded GPR37 by promoting their degradation. SYVN1 sequesters p53/TP53 in the cytoplasm and promotes its degradation, thereby negatively regulating its biological function in transcription, cell cycle regulation, and apoptosis. It mediates the ubiquitination and subsequent degradation of cytoplasmic NFE2L1. During the early stage of B cell development, SYVN1 is required for degradation of the pre-B cell receptor (pre-BCR) complex, hence supporting further differentiation into mature B cells.
Gene References Into Functions
  1. This study showed that Herp stability was regulated by synoviolin through lysine ubiquitination-independent proteasomal degradation. PMID: 29863080
  2. Hrd1 is an E3 ubiquitin ligase in human T cells. IHrd1 expression is increased in CD4-positive T cells from multiple sclerosis patients. PMID: 27417417
  3. PADI4 interacted with SYVN1 directly and that overexpression of PADI4 suppressed the ubiquitination of proteins. Thus, a reduction in ER stress induced by PADI4 may abrogate the initiation of chronic RA by suppressing the proliferative signals of RA synoviocytes. PMID: 29039504
  4. Amyloid beta oligomers modulate BACE1 through an XBP-1-dependent pathway involving HRD1. PMID: 27853315
  5. findings support a model of Hrd1 complex formation, where the Hrd1 cytoplasmic domain and FAM8A1 have a central role in the assembly and activity of this ERAD machinery. PMID: 28827405
  6. HSP70-Hrd1 axis represents a potential therapeutic target for restoring the oncorepressor activity of unstable lymphoma-associated Blimp-1 mutants. PMID: 28842558
  7. this study proved that SYVN1 enhances SERPINA1(E342K)/ATZ degradation through SQSTM1-dependent autophagy and attenuates SERPINA1(E342K)/ATZ cytotoxicity. PMID: 28121484
  8. Results demonstrated that overexpression of Hrd1 increased the proteasomal degradation and microtubule-dependent aggresome formation of OPTN in the microtubular organizing center, whereas knockdown of Hrd1 stabilized OPTN and inhibited aggresome formation of OPTN. PMID: 28334804
  9. Data show that E3 ubiquitin ligase HRD1 (HRD1) decreased the protein level of S100A8 through ubiquitination. PMID: 28423597
  10. Analysis of affinity-captured Hrd1 complexes from these cells by size-exclusion chromatography, immunodepletion, and absolute quantification mass spectrometry identified two major high-molecular-mass complexes with distinct sets of interacting proteins and variable stoichiometries, suggesting a hitherto unrecognized heterogeneity in the functional units of Hrd1-mediated protein degradation. PMID: 28411238
  11. This study provides new knowledge of the CFTR biosynthetic pathway. It suggests that SYVN1 and FBXO2 represent two distinct multiprotein complexes that may degrade DeltaF508-CFTR in airway epithelia and identifies a new role for NEDD8 in regulating DeltaF508-CFTR ubiquitination. PMID: 27756846
  12. Study shows that mir125b is up-regulated in osteoarthritis (OA) and inversely correlated with SYNV1 expression. Also, findings demonstrated that miR- 125b-5p could promote apoptosis of synovial cells through targeting the SYVN1 gene, and the excessive apoptosis of synovial cells could contribute to the development of OA. PMID: 28260078
  13. HRD1 is a novel substrate for USP19. USP19 negatively regulates the ubiquitination of HRD1 and prevents it from undergoing proteasomal degradation. PMID: 27827840
  14. Prion protein mutants inhibit Hrd1-mediated retrotranslocation of misfolded proteins by depleting misfolded protein sensor BiP. PMID: 26740554
  15. OS-9, an ER-resident lectin, acts downstream of Grp94 to further recognize misfolded alpha1 subunits in a glycan-dependent manner. This delivers misfolded alpha1 subunits to the Hrd1-mediated ubiquitination and the valosin-containing protein-mediated extraction pathway. PMID: 26945068
  16. These findings uncover a novel role for HRD1 in breast cancer. PMID: 26536657
  17. The inherently unstable nature of the human SEL1L protein lies in its transmembrane domain, and that association of HRD1 with the SEL1L transmembrane domain restored its stability. PMID: 26471130
  18. specific silencing of Derlin-2, p97 and HRD1 by shRNAs increases steady state levels of proinsulin. these ERAD constituents are critically involved in proinsulin degradation and may therefore also play a role in subsequent antigen generation. PMID: 26107514
  19. Charcot-Marie-Tooth disease-related PMP22 is trapped in the endoplasmic reticulum by calnexin-dependent retention and Rer1-mediated early Golgi retrieval systems and partly degraded by the Hrd1-mediated endoplasmic reticulum-associated degradation system. PMID: 25385046
  20. Results show that HRD1 and RFP2 contributes are required for the disposal of V247M alpha-sarcoglycan mutant. PMID: 24565866
  21. Herp localizes to the endoplasmic reticulum-derived quality control compartment (ERQC) and recruits HRD1, which targets to endoplasmic reticulum associated degradation the substrate presented by the OS-9 lectin at the ERQC. PMID: 24478453
  22. identified Hrd1 as a novel E3 ubiquitin ligase responsible for compromised Nrf2 response during liver cirrhosis PMID: 24636985
  23. a new HRD1-associated membrane protein named HERP2, which is homologous to the previously identified HRD1 partner HERP1. Despite sequence homology, HERP2 is constitutively expressed in cells, whereas HERP1 is highly induced by ER stress. PMID: 24366871
  24. the interactions between P97 and these motifs, including VCP-binding motif (VBM) and VCP-interacting motif (VIM). The solution structures of the VBM motif from HRD1 and the VIM motif from SVIP are both comprised mainly of a single alpha-helix. PMID: 24100225
  25. derlin2 functions with HRD1 in ERAD of certain substrates independent of their glycosylation status. PMID: 23867461
  26. subset of integral membrane proteins, therefore, requires an early dislocation event to expose part of their luminal domain to the cytosol, before HRD1-mediated polyubiquitination and dislocation PMID: 23929775
  27. Synoviolin up-regulates amyloid beta production by targeting a negative regulator of gamma-secretase, Rer1, for degradation. PMID: 23129766
  28. Hrd1 functions as an E3 targeting tau or abnormal p-tau for proteasome degradation. PMID: 22280354
  29. regulation of the stability and assembly of the HRD1-SEL1L complex is critical to optimize the degradation kinetics of ERAD substrates PMID: 21454652
  30. binding of Herp to Hrd1-containing ERAD complexes positively regulates the ubiquitylation activity of these complexes, thus permitting survival of the cell during ER stress. PMID: 21149444
  31. data support a physiological role for HRD1 and UBE2J1 in the homeostatic regulation of MHC class I assembly and expression PMID: 21245296
  32. Using brain tissue from Alzheimer's disease and normal subjects, a negative correlation was found between the expressed levels of HRD1 and of amyloid-beta; this suggests the possible involvement of HRD1 in amyloid-beta generation. PMID: 20606367
  33. serine-dependent, HRD1-mediated ubiquitination targets TCRalpha to the ERAD pathway PMID: 20519503
  34. HRD1 promotes ubiquitination and degradation of amyloid precursor protein (APP) that leads to decreased amyloid beta production, whereas HRD1 loss in Alzheimer's disease leads to accumulation of APP and increased levels of amyloid beta. PMID: 20237263
  35. These data demonstrate a role of the E3 ubiquitin ligases in CTA1 retro-translocation. PMID: 19864457
  36. The results support that gp78 is an E3 targeting CFTRDeltaF508 for degradation and Hrd1 inhibits CFTRDeltaF508 degradation by acting as an E3 for gp78. PMID: 19828134
  37. HRD1 protects against endoplasmic reticulum stress-induced apoptosis through endoplasmic reticulum-associated degradation. PMID: 12459480
  38. endogenous hHrd1 resides in the ER and has a ubiquitin-ligase activity PMID: 12646171
  39. Human HRD1 is an E3 ubiquitin ligase involved in degradation of proteins from the endoplasmic reticulum PMID: 14593114
  40. Results showed that Synoviolin, a novel causative factor for rheumatoid arthritis, is up-regulated in proliferating synovial cells in the disease. PMID: 16786162
  41. Elevated peripheral blood (PB) levels of synoviolin were associated with nonresponse to infliximab treatment. Upregulation of synoviolin by IL-lbeta and TNFalpha may contribute to prolonged survival of immune cells and rheumatoid arthritis chronicity. PMID: 16802346
  42. These results suggest that Hrd1 is a novel htt-interacting protein that can target pathogenic httN for degradation and is able to protect cells against httN-induced cell death. PMID: 17141218
  43. the endoplasmic reticulum-resident ubiquitin ligase 'Synoviolin' destroys p53 PMID: 17170702
  44. endoplasmic reticulum stress-induced HRD1 and SEL1 expressions are mediated by IRE1-XBP1- and ATF6-dependent pathways, respectively PMID: 17967421
  45. overexpressed in the synovial cells of patients with rheumatoid arthritis, resulting in a state in which the cell deals with accumulated unfolded proteins excessively PMID: 18235538
  46. OS-9 and GRP94 deliver mutant alpha1-antitrypsin to the Hrd1-SEL1L ubiquitin ligase complex for ERAD PMID: 18264092
  47. These findings reveal a role for SEL1L and HRD1 in IgM quality control. PMID: 18314878
  48. proline-rich domain of HRD1 is necessary to promote the degradation of Pael-R and that the protein's transmembrane domain is necessary to transfer Pael-R from the endoplasmic reticulum (ER) to the cytosol. PMID: 18344614
  49. XTP3-B forms an endoplasmic reticulum quality control scaffold with the HRD1-SEL1L ubiquitin ligase complex and BiP PMID: 18502753
  50. analysed the promoter of human HRD1, which encodes an E3 ubiquitin ligase, an important component of ERAD PMID: 18664523

Show More

Hide All

Database Links

HGNC: 20738

OMIM: 608046

KEGG: hsa:84447

STRING: 9606.ENSP00000366395

UniGene: Hs.75859

Protein Families
HRD1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed, with highest levels in liver and kidney (at protein level). Up-regulated in synovial tissues from patients with rheumatoid arthritis (at protein level).

Q&A

What is the molecular structure of SYVN1 and how does it contribute to its function?

SYVN1, also known as Hrd1 or Der3, is an ER-resident E3 ubiquitin ligase characterized by its RING domain, which is essential for its ubiquitin ligase activity. The protein contains a SyU domain with evolutionarily conserved arginine residues (R266/R267) that are crucial for substrate binding . The RING domain contains cysteine residues that are vital for its catalytic function, as demonstrated by the C329S mutation which diminishes its E3 ligase activity .

The functional domains of SYVN1 work cooperatively to recognize, bind, and ubiquitinate target proteins. This structure allows SYVN1 to participate in the ERAD pathway, where it tags misfolded or unneeded proteins for proteasomal degradation. Experimental approaches to study these structural elements typically involve site-directed mutagenesis, such as the RING domain mutant (SYVN1 C329S) which has significantly reduced ubiquitination activity compared to wild-type SYVN1 .

How do researchers produce and validate recombinant SYVN1 for experimental use?

For recombinant SYVN1 production, researchers typically use mammalian expression systems (HEK 293T cells) rather than bacterial systems due to the need for proper protein folding and post-translational modifications. The methodological approach involves:

  • Cloning the full-length human SYVN1 cDNA into expression vectors with tags (FLAG, HA) for detection and purification

  • Transfecting expression vectors into mammalian cells using Lipofectamine 2000 or similar reagents

  • Harvesting cells after 24-48 hours and lysing in appropriate buffers (typically containing 20 mM Tris-HCl, pH 8.0; 100 mM NaCl; 1 mM EDTA; 1% NP-40; and protease inhibitors)

  • Purifying recombinant protein using affinity chromatography based on the attached tags

Validation of recombinant SYVN1 functionality should include in vitro ubiquitination assays containing ATP, ubiquitin, E1, E2, and the substrate protein to confirm E3 ligase activity . Western blotting is then used to detect polyubiquitinated products.

How does SYVN1 regulate ER morphology and what are the implications for cellular function?

SYVN1 regulates ER morphology primarily through its interaction with and ubiquitination of Atlastins (ATLs), particularly ATL1. Research has demonstrated that overexpression of SYVN1 disrupts the normal ER network structure, leading to abnormal ER morphology . This disruption appears to be dependent on SYVN1's E3 ubiquitin ligase activity, as the RING domain mutant SYVN1 C329S shows significantly reduced capacity to alter ER structure .

The mechanism involves SYVN1-mediated ubiquitination of ATL1, which inhibits ATL1's GTPase activity without causing protein degradation . Since ATL1 is critical for mediating homotypic membrane fusion in the ER, this inhibition directly affects ER tubule formation and network maintenance. Interestingly, co-expression of ATL1 with SYVN1 partially recovers normal ER structure, suggesting a balanced regulatory relationship .

Functionally, this regulation impacts ER-dependent cellular processes, particularly COPII vesicle export. Studies measuring SEC31A puncta (a marker for COPII vesicles) show that SYVN1 overexpression decreases COPII vesicle formation by approximately 30%, while co-expression with ATL1 restores vesicle numbers to normal levels . This indicates SYVN1's crucial role in membrane trafficking and protein transport from the ER to the Golgi apparatus.

What role does SYVN1 play in ER stress and the unfolded protein response?

SYVN1, as a key ERAD E3 ubiquitin ligase, functions as a critical regulator during ER stress and the unfolded protein response (UPR). When the ER experiences stress due to accumulation of misfolded proteins, SYVN1 mediates the ubiquitination of these proteins, targeting them for proteasomal degradation to maintain ER homeostasis.

Research has shown that SYVN1 knockdown results in increased levels of ER stress markers such as GRP78 (Glucose-regulated protein 78) and CHOP (C/EBP homologous protein) . In a study using AAV-mediated SYVN1 knockdown in rat striatum neurons, researchers observed significantly elevated levels of both GRP78 and CHOP compared to control groups . This demonstrates that reduced SYVN1 activity impairs the cell's ability to resolve ER stress, potentially leading to prolonged UPR activation.

The methodological approach to study this connection includes:

  • Knockdown of SYVN1 using shRNA delivered via lentiviral or AAV vectors

  • Measurement of ER stress markers by Western blotting

  • Subcellular fractionation to isolate ER compartments and analyze protein accumulation in different cellular locations

This research highlights SYVN1's importance in preventing chronic ER stress, which can lead to cellular dysfunction and contribute to various pathological conditions.

How does SYVN1 interact with Atlastins to regulate ER morphology?

SYVN1 directly interacts with Atlastins (ATLs), particularly ATL1, to control ER shape through a ubiquitination mechanism that surprisingly does not lead to protein degradation. In experimental studies, SYVN1 has been shown to ubiquitinate ATL1 predominantly at the K285 residue and to a lesser extent at K287 . This ubiquitination event functionally inhibits ATL1's GTPase activity rather than targeting it for degradation.

The interaction mechanism has been characterized through immunoprecipitation assays that demonstrate the physical binding between SYVN1 and ATL1 in both overexpression systems and under endogenous conditions . The functional relationship between these proteins is evidenced by ER morphology rescue experiments, where abnormal ER structure caused by SYVN1 overexpression can be partially normalized by co-expressing ATL1 .

This SYVN1-ATL1 regulatory axis directly impacts ER-Golgi trafficking, as measured by the formation of COPII vesicles marked by SEC31A. Quantitative analysis shows that SYVN1 overexpression reduces SEC31A-positive vesicles by approximately 30%, while co-expression with ATL1 restores vesicle counts to control levels . This suggests a balance between these proteins is essential for normal ER function and morphology.

What is the molecular mechanism of PGC-1β regulation by SYVN1 and how does it impact energy metabolism?

SYVN1 regulates peroxisome proliferator-activated receptor gamma coactivator 1-beta (PGC-1β) through direct ubiquitination, establishing a critical link between ERAD and energy metabolism. Research has identified the precise molecular interaction: SYVN1 contains a SyU domain with conserved arginine residues (R266/R267) that are crucial for binding to PGC-1β, while PGC-1β's binding domain maps to amino acids 195-367, containing an LXXLL motif .

This interaction has been validated through multiple experimental approaches:

  • GST pull-down assays to map the binding domains

  • Co-immunoprecipitation studies in HEK 293T cells with overexpressed proteins

  • Endogenous immunoprecipitation demonstrating physiologically relevant interaction

Functionally, SYVN1 ubiquitinates PGC-1β and targets it for proteasomal degradation, as demonstrated through in vitro ubiquitination assays with ATP, HA-Ub, E1, E2, and SYVN1 . The significance of this regulation is evident in SYVN1-deficient mice, which show upregulation of PGC-1β target genes, increased mitochondrial number and respiration, and elevated basal energy expenditure in adipose tissue .

The metabolic consequences of this regulatory mechanism are substantial: SYVN1 knockout mice exhibit resistance to weight gain and reduced white adipose tissue accumulation, even in genetically obese (ob/ob and db/db) backgrounds . This positions SYVN1 as a potential therapeutic target for obesity treatment.

How does SYVN1 deficiency affect body weight and adipose tissue development?

SYVN1 deficiency leads to significant changes in body weight regulation and adipose tissue development through multiple mechanisms. Studies using conditional SYVN1 knockout mice demonstrated weight loss and reduced white adipose tissue accumulation compared to control animals . This phenotype was observed not only in otherwise wild-type animals but also in genetically obese (ob/ob and db/db) mouse models .

The underlying mechanism involves SYVN1's regulation of PGC-1β, a key thermogenic coactivator. When SYVN1 is absent, PGC-1β protein levels increase due to reduced ubiquitination and subsequent degradation . This leads to upregulation of PGC-1β target genes involved in mitochondrial biogenesis and energy expenditure.

Quantitative analysis of adipose tissue from SYVN1-deficient mice revealed:

  • Increased mitochondrion number

  • Enhanced respiratory capacity

  • Elevated basal energy expenditure

These metabolic changes collectively contribute to reduced adiposity and resistance to obesity. Importantly, the selective SYVN1 inhibitor LS-102 was shown to prevent weight gain in mice, highlighting the potential therapeutic application of targeting this pathway for obesity treatment .

What is the relationship between SYVN1, inflammation, and metabolic regulation?

SYVN1 represents an important molecular link between inflammatory signaling and metabolic regulation. Research has established that SYVN1 is a key target for inflammatory cytokines including tumor necrosis factor α (TNFα), interleukin-1 (IL-1), and interleukin-17 (IL-17) . This connection is particularly significant given the well-established role of chronic inflammation in metabolic disorders.

The relationship between SYVN1 and inflammation extends to its roles in rheumatoid arthritis and fibrosis, conditions with strong inflammatory components . The molecular mechanisms involve cytokine-mediated regulation of SYVN1 expression, which in turn affects metabolic parameters through multiple pathways, including PGC-1β regulation.

To study this relationship experimentally, researchers have employed several approaches:

  • Analysis of SYVN1 expression levels in response to inflammatory cytokine treatment

  • Examination of metabolic parameters in conditions of both inflammation and SYVN1 modulation

  • Luciferase reporter assays to measure the impact of SYVN1 on transcriptional activity of metabolic regulators like PPARα

The experimental evidence suggests a model where inflammatory signals upregulate SYVN1, which then suppresses PGC-1β activity, potentially contributing to the metabolic dysfunction observed in inflammatory conditions. This positions SYVN1 as a potential therapeutic target at the intersection of inflammation and metabolism.

How is SYVN1 involved in neurological functions and pathologies?

SYVN1 has emerging roles in neurological function through its regulation of key neuronal proteins. Research has revealed that SYVN1 mediates the ubiquitination and degradation of GABA A receptor α1 subunit (GABA Aα1) in the dorsal striatum (Dstr), particularly in the context of methamphetamine (METH) conditioned place preference (CPP) . This finding connects SYVN1 to neurotransmitter receptor homeostasis and potentially to addiction-related neuroadaptations.

Experimental evidence supporting this neurological role comes from both in vitro and in vivo studies:

  • In primary Dstr neurons, SYVN1 knockdown via lentiviral shRNA significantly increased GABA Aα1 expression by approximately 80% compared to controls

  • In vivo AAV-mediated SYVN1 knockdown in rat striatum similarly increased GABA Aα1 protein levels by approximately 52%

  • Subcellular fractionation studies demonstrated that this increased GABA Aα1 accumulates specifically in the intra-ER fraction rather than the extra-ER compartment

These findings suggest that SYVN1 functions in quality control of GABA Aα1 receptors during their biosynthesis and processing in the ER. Dysfunction in this pathway could potentially contribute to altered inhibitory neurotransmission and neurological disorders associated with GABAergic signaling imbalance.

What are the implications of SYVN1's regulation of Atlastins for neurodegenerative diseases?

SYVN1's regulation of Atlastins, particularly ATL1, has significant implications for neurodegenerative diseases, especially hereditary spastic paraplegia (HSP). ATL1 is a dynamin-like GTPase critical for ER membrane fusion, and defects in ATL1 function are directly linked to HSP, a neurodegenerative condition characterized by progressive spasticity .

Research has established that SYVN1 ubiquitinates ATL1 primarily at residue K285, with secondary ubiquitination at K287 . This modification inhibits ATL1's GTPase activity without triggering protein degradation, thereby modulating ER morphology and function. The abnormal ER structure resulting from dysregulated SYVN1-ATL1 interaction may contribute to neuronal dysfunction observed in HSP.

The functional consequence of this regulation extends to COPII vesicle formation and trafficking, which is essential for neuronal protein delivery and axonal maintenance. Quantitative analysis shows that SYVN1 overexpression reduces COPII vesicle formation by approximately 30%, an effect that can be counteracted by ATL1 co-expression .

These findings suggest potential therapeutic approaches targeting the SYVN1-ATL1 axis for HSP and possibly other neurodegenerative conditions involving ER dysfunction. Modulating SYVN1 activity could potentially normalize ATL1 function and restore proper ER morphology and trafficking in affected neurons.

What are the optimal techniques for detecting SYVN1-substrate interactions?

Detecting SYVN1-substrate interactions requires a combination of complementary techniques to establish both physical binding and functional ubiquitination. Based on published research methodologies, the following approach is recommended:

For physical interaction detection:

  • Co-immunoprecipitation (Co-IP): The gold standard for detecting protein-protein interactions in cells. For SYVN1 studies, cell lysates should be prepared in a buffer containing 20 mM Tris-HCl (pH 8.0), 100 mM NaCl, 1 mM EDTA, 1% NP-40, and protease inhibitors . When studying endogenous interactions, a more specialized buffer composition is recommended: 100 mM Tris-HCl, 80 mM NaCl, 1 mM EDTA, 5 mM EGTA, 5% glycerol, 2% digitonin, 0.1% Brij 35, protease inhibitor cocktail, and 20 mM MG132 .

  • GST pull-down assays: For mapping specific binding domains. This approach successfully identified that SYVN1 binds to PGC-1β through its SyU domain, while PGC-1β's binding domain maps to amino acids 195-367 .

For functional ubiquitination detection:

  • In vitro ubiquitination assay: Combine purified components including ATP, ubiquitin (tagged with HA or FLAG for detection), E1 enzyme, E2 enzyme, SYVN1, and the substrate protein of interest. Analyze ubiquitination products by western blotting .

  • In vivo ubiquitination assay: Co-express tagged ubiquitin (FLAG-Ub) with the substrate protein (e.g., HA-PGC-1β) and either wild-type SYVN1 or the catalytically inactive mutant SYVN1(3S) in HEK 293T cells. After immunoprecipitation, detect ubiquitination by western blotting .

These techniques have successfully characterized SYVN1 interactions with multiple substrates including ATL1 and PGC-1β , providing a methodological framework for identifying new SYVN1 targets.

How can researchers effectively modulate SYVN1 expression and activity in experimental systems?

Researchers have employed multiple strategies to modulate SYVN1 expression and activity in experimental systems, each with specific advantages for different research questions:

For SYVN1 knockdown:

  • RNA interference: siRNAs targeting human SYVN1 have been effectively used in cell culture models . For mouse studies, validated siRNAs for mouse Syvn1 are commercially available from providers like Ambion . Transfection is typically performed using Lipofectamine 2000 for optimal delivery.

  • Viral vector-mediated shRNA delivery:

    • Lentiviral vectors (Lenti-SYVN1) for in vitro studies, showing approximately 60% knockdown efficiency in primary neurons

    • AAV vectors (AAV-SYVN1) for in vivo studies, achieving approximately 40% knockdown in striatal tissue

For SYVN1 overexpression:

  • Plasmid transfection: Expression vectors containing wild-type SYVN1 or mutant variants. The C329S mutation in the RING domain creates a catalytically inactive variant useful for distinguishing E3 ligase-dependent functions .

  • Domain-specific mutants: The R266A/R267A double mutation in the SyU domain decreases substrate binding without affecting E3 ligase activity, allowing researchers to separate binding from catalytic functions .

For pharmacological inhibition:
The selective SYVN1 inhibitor LS-102 has been shown to prevent weight gain in mice by abolishing the negative regulation of PGC-1β . This compound provides a valuable tool for acute inhibition studies without genetic manipulation.

For generating knockout models:
Conditional knockout strategies using Cre-loxP systems allow tissue-specific and temporally controlled deletion of Syvn1, as demonstrated in studies of adipose tissue function .

Each approach should be validated by measuring SYVN1 expression levels via Western blot or qPCR to confirm the effectiveness of the intervention.

What are the emerging therapeutic applications targeting SYVN1?

Recent research has identified several promising therapeutic applications targeting SYVN1, particularly in metabolic and neurological disorders. The most advanced therapeutic direction involves SYVN1 inhibition for obesity treatment. The selective SYVN1 inhibitor LS-102 has demonstrated efficacy in preventing weight gain in mouse models by abolishing the negative regulation of PGC-1β by SYVN1 . This approach leverages SYVN1's role in regulating mitochondrial biogenesis and energy expenditure in adipose tissue.

The mechanism involves blocking SYVN1-mediated ubiquitination of PGC-1β, which increases PGC-1β protein levels and activity, leading to:

  • Upregulation of genes involved in mitochondrial function

  • Increased mitochondrial number and respiration

  • Enhanced basal energy expenditure in adipose tissue

Beyond obesity, emerging therapeutic applications include potential interventions for:

  • Neurodegenerative disorders: Targeting the SYVN1-ATL1 axis could potentially normalize ER morphology and function in hereditary spastic paraplegia and related conditions

  • ER stress-related pathologies: Modulating SYVN1 activity may help manage conditions characterized by chronic ER stress and UPR activation

  • Inflammatory disorders: Given SYVN1's responsiveness to inflammatory cytokines like TNFα, IL-1, and IL-17, it represents a potential target for conditions with inflammatory components

The development of more selective and potent SYVN1 modulators remains an active area of research, with potential for significant therapeutic advances in the coming years.

What are the key methodological challenges in studying SYVN1 and how might they be addressed?

Studying SYVN1 presents several unique methodological challenges that researchers must address to advance our understanding of this important E3 ubiquitin ligase:

Challenge 1: Distinguishing degradative from non-degradative ubiquitination
SYVN1 has been shown to mediate both degradative ubiquitination (e.g., PGC-1β) and non-degradative ubiquitination (e.g., ATL1) . Differentiating between these outcomes requires careful experimental design.

Solution approach: Combine ubiquitination assays with protein stability measurements. For suspected non-degradative ubiquitination, researchers should perform cycloheximide chase experiments to monitor protein stability over time and use mass spectrometry to identify specific ubiquitination sites and chain types.

Solution approach: Utilize conditional knockout models with tissue-specific Cre drivers and temporal control (e.g., tamoxifen-inducible systems) as demonstrated in adipose tissue-specific studies . This allows precise analysis of SYVN1 function in specific contexts.

Challenge 3: ER membrane localization complicating biochemical analysis
As an ER-resident membrane protein, SYVN1 can be difficult to solubilize while maintaining its native interactions.

Solution approach: Optimize membrane protein extraction using specialized detergent combinations (e.g., digitonin with Brij 35) . For subcellular localization studies, combine biochemical fractionation with microscopy approaches to validate findings, as demonstrated in studies of GABA Aα1 localization .

Challenge 4: Multiple overlapping cellular roles
SYVN1's involvement in both ERAD and other regulatory pathways makes it difficult to isolate specific functions.

Solution approach: Develop domain-specific mutants that selectively disrupt certain functions while preserving others, such as the R266A/R267A binding mutant and C329S catalytic mutant . These tools allow researchers to dissect specific aspects of SYVN1 function in isolation.

Addressing these methodological challenges will be crucial for further elucidating SYVN1's complex roles in cellular physiology and pathology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.