Recombinant Human Ectonucleoside triphosphate diphosphohydrolase 4 (ENTPD4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ENTPD4; KIAA0392; LALP70; LYSAL1; Ectonucleoside triphosphate diphosphohydrolase 4; NTPDase 4; Golgi UDPase; Lysosomal apyrase-like protein of 70 kDa; Uridine-diphosphatase; UDPase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-616
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ENTPD4
Target Protein Sequence
MGRIGISCLFPASWHFSISPVGCPRILNTNLRQIMVISVLAAAVSLLYFSVVIIRNKYGR LTRDKKFQRYLARVTDIEATDTNNPNVNYGIVVDCGSSGSRVFVYCWPRHNGNPHDLLDI RQMRDKNRKPVVMKIKPGISEFATSPEKVSDYISPLLNFAAEHVPRAKHKETPLYILCTA GMRILPESQQKAILEDLLTDIPVHFDFLFSDSHAEVISGKQEGVYAWIGINFVLGRFEHI EDDDEAVVEVNIPGSESSEAIVRKRTAGILDMGGVSTQIAYEVPKTVSFASSQQEEVAKN LLAEFNLGCDVHQTEHVYRVYVATFLGFGGNAARQRYEDRIFANTIQKNRLLGKQTGLTP DMPYLDPCLPLDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPP IHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILRERFDRGLYASH ADLHRLKYQCFKSAWMFEVFHRGFSFPVNYKSLKTALQVYDKEVQWTLGAILYRTRFLPL RDIQQEAFRASHTHWRGVSFVYNHYLFSGCFLVVLLAILLYLLRLRRIHRRTPRSSSAAA LWMEEGLPAQNAPGTL
Uniprot No.

Target Background

Function
Recombinant Human Ectonucleoside triphosphate diphosphohydrolase 4 (ENTPD4) catalyzes the hydrolysis of nucleoside triphosphates and diphosphates in a calcium- or magnesium-dependent manner, exhibiting a preference for pyrimidines. It preferentially hydrolyzes UTP and TTP, while AMP, ADP, ATP, and UMP are not substrates. Ca2+ is a more effective activator than Mg2+. ENTPD4 demonstrates broad substrate specificity, cleaving most nucleotide di- and triphosphates except for ADP and ATP. It preferentially hydrolyzes CTP, UDP, CDP, GTP, and GDP, and utilizes Ca2+ or Mg2+ equally.
Gene References Into Functions
  1. NTPDASE4 gene products interact with the adenovirus E4orf4 protein via PP2A-dependent and -independent pathways, contributing to apoptosis induction. [PMID: 24672025](https://www.ncbi.nlm.nih.gov/pubmed/24672025)
  2. This study found no evidence linking ENTPD4 gene variations to schizophrenia etiology in the Japanese population. [PMID: 20537721](https://www.ncbi.nlm.nih.gov/pubmed/20537721)
  3. The VSFASSQQ motif confers calcium sensitivity to LALP70 during UDP cleavage. [PMID: 15200686](https://www.ncbi.nlm.nih.gov/pubmed/15200686)
Database Links

HGNC: 14573

OMIM: 607577

KEGG: hsa:9583

STRING: 9606.ENSP00000351520

UniGene: Hs.444389

Protein Families
GDA1/CD39 NTPase family
Subcellular Location
[Isoform 1]: Cytoplasmic vesicle, autophagosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.; [Isoform 2]: Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous. Highest expression in testis and lowest in bladder.

Q&A

Basic Research Questions

  • What is the basic structure and function of human ENTPD4?

ENTPD4, also known as UDPase or LALP70 (Lysosomal Apyrase-Like Protein of 70 kDa), is a membrane-bound glycoprotein that catalyzes the hydrolysis of nucleoside diphosphates, with a preference for UDP over other nucleotides. Unlike other ENTPD family members such as ENTPD3 (which preferentially hydrolyzes ATP and other triphosphates), ENTPD4 demonstrates optimal activity at acidic pH, reflecting its predominantly intracellular localization in lysosomes and secretory vesicles.

The protein typically consists of an N-terminal transmembrane domain, a large extracellular catalytic domain containing the conserved apyrase regions responsible for nucleotide binding and hydrolysis, and a C-terminal domain. For recombinant expression purposes, truncated versions lacking the transmembrane domains may be produced to generate soluble, secreted forms that retain enzymatic activity, similar to the approach used for ENTPD3 .

  • How should I store and handle recombinant human ENTPD4?

Recombinant ENTPD4 should be stored according to manufacturer specifications, typically at -80°C for long-term storage, with aliquoting recommended to avoid repeated freeze-thaw cycles that can compromise protein activity. Based on protocols for similar proteins like ENTPD3, upon receipt of recombinant ENTPD4, it should be immediately stored at the recommended temperature .

For working solutions, the protein can be diluted in an appropriate buffer containing calcium (typically 1-5 mM CaCl₂), as calcium ions are essential cofactors for ENTPD enzyme activity. When handling the protein, minimize exposure to proteases and maintain sterile technique. If carrier-free formulations are used, special attention should be given to potential loss of protein due to adsorption to tubes or pipette tips, which can be mitigated through the addition of carrier proteins like BSA for non-assay storage purposes .

  • What expression systems are commonly used for producing recombinant human ENTPD4?

Recombinant human ENTPD4 is typically produced in mammalian expression systems to ensure proper folding, post-translational modifications, and glycosylation patterns essential for enzymatic activity. Common expression systems include:

  • HEK293 cells: Provide human-compatible glycosylation and are widely used for secreted and membrane proteins

  • CHO cells: Offer robust growth characteristics and high protein yields

  • Insect cell systems (e.g., Sf9, Hi5): Can produce higher yields but with different glycosylation patterns

For proper expression, the construct design should consider whether to include or exclude the transmembrane domains, depending on the desired application. For enzymatic studies, a soluble ectodomain version with an affinity tag (e.g., His-tag) for purification may be preferable, similar to the approach described for ENTPD3, which utilized a C-terminal 6-His tag on a construct spanning from Gln44 to Pro485 .

Advanced Research Questions

  • How do I optimize enzyme activity assays for recombinant ENTPD4?

ENTPD4 enzyme activity assays require careful optimization due to the protein's unique pH-dependent activity profile and substrate preferences. Based on protocols for related enzymes like ENTPD3, a robust assay design would include:

Optimized Assay Conditions for ENTPD4:

ParameterRecommended ConditionRationale
Buffer SystemMES buffer (pH 5.5-6.5)ENTPD4 shows optimal activity at acidic pH
Divalent Cations1-5 mM CaCl₂Essential cofactor for catalytic activity
Temperature37°CPhysiological temperature optimum
SubstrateUDP (primary), other NDPsReflects ENTPD4's substrate preference
Detection MethodMalachite Green AssaySensitive detection of released phosphate

For a quantitative enzyme activity assay:

  • Dilute recombinant ENTPD4 to 0.01-0.05 μg/mL in assay buffer

  • Prepare a phosphate standard curve (0.039 to 2.5 nmol range)

  • Add substrate (typically 50-100 μM UDP) to initiate the reaction

  • Incubate at 37°C for 20-30 minutes

  • Detect released phosphate using the Malachite Green Phosphate Detection method

  • Calculate specific activity using the formula:

Specific Activity (pmol/min/μg) = [Phosphate released (nmol) × 1000 pmol/nmol] / [Incubation time (min) × enzyme amount (μg)]

This approach allows for quantitative assessment of enzyme activity and is suitable for both quality control and comparative studies .

  • What are the key differences in experimental design when studying ENTPD4 compared to other ENTPD family members?

When studying ENTPD4 compared to other ENTPD family members such as ENTPD3, several critical experimental design differences must be considered:

  • pH optimization: Unlike ENTPD1, ENTPD2, and ENTPD3 which function optimally at neutral to slightly alkaline pH, ENTPD4 requires acidic pH conditions (pH 5.5-6.5) to achieve maximal activity. This necessitates different buffer systems for comparative studies.

  • Substrate selection: ENTPD4 preferentially hydrolyzes UDP and other nucleoside diphosphates, showing minimal activity toward ATP and other triphosphates. In contrast, ENTPD3 preferentially hydrolyzes ATP, ADP, UTP, and UDP as substrates. When designing substrate panels, include both di- and triphosphates to accurately characterize enzymatic preferences.

  • Localization studies: While most ENTPDs (ENTPD1-3) are primarily ectoenzymes expressed at the cell surface, ENTPD4 is predominantly localized to intracellular compartments, particularly lysosomes and secretory vesicles. This requires different approaches for cellular localization studies, including lysosomal markers rather than plasma membrane markers.

  • Physiological context: When interpreting results, consider that ENTPD4's intracellular localization and pH optimum suggest functions distinct from extracellular nucleotide hydrolysis associated with other family members, potentially relating to glycosylation processes in the Golgi or protein quality control.

These differences highlight the importance of customizing experimental conditions when studying individual ENTPD family members rather than applying a one-size-fits-all approach .

  • How should I design qPCR experiments to accurately measure ENTPD4 expression levels?

Designing qPCR experiments for ENTPD4 expression analysis requires careful consideration of several critical factors to ensure reliable and reproducible results:

Primer and Probe Design Considerations:

  • Analyze transcript variants and exon organization of ENTPD4 in databases like Ensembl

  • Design primers spanning exon-exon junctions to prevent genomic DNA amplification

  • Check for SNPs in primer/probe binding regions to avoid amplification bias

  • Ensure primers generate short amplicons (70-150 bp) for optimal efficiency

  • Confirm primer specificity using BLAST to avoid cross-reactivity with other ENTPD family members

Experimental Protocol Optimization:

  • Extract RNA using methods that preserve integrity, as degraded RNA will compromise results

  • Include rigorous quality control of RNA (RIN > 7 recommended) before cDNA synthesis

  • Implement a consistent reverse transcription protocol, as this step introduces significant variability

  • Run sufficient technical (minimum 3) and biological replicates (minimum 3) to account for variability

  • Include no-template and no-RT controls to detect contamination or genomic DNA

Reference Gene Selection:
Traditional housekeeping genes like GAPDH and ACTB have been shown to vary considerably under different experimental conditions. For ENTPD4 expression studies:

  • Test multiple candidate reference genes (at least 3-4) under your specific experimental conditions

  • Use algorithms like geNorm, NormFinder, or BestKeeper to identify the most stable references

  • Consider using multiple reference genes for normalization to improve accuracy

Following these guidelines will help ensure that qPCR analysis of ENTPD4 expression yields accurate and reproducible results across different experimental conditions and sample types.

Methodological Considerations

  • What approaches can be used to investigate the functional impact of ENTPD4 in cellular systems?

To investigate ENTPD4's functional impact in cellular systems, researchers can employ several complementary approaches:

Genetic Manipulation Strategies:

  • CRISPR/Cas9 gene editing: Create ENTPD4 knockout cell lines to observe loss-of-function effects

  • siRNA/shRNA knockdown: For temporary reduction of ENTPD4 expression

  • Overexpression systems: Transfect cells with ENTPD4 expression constructs (wild-type or mutants)

  • Inducible expression systems: Allow temporal control of ENTPD4 expression

Functional Assays:

  • Nucleotide metabolism: Measure changes in intracellular UDP/UTP ratios using HPLC or mass spectrometry

  • Glycosylation analysis: Assess alterations in protein glycosylation patterns using lectin blotting or mass spectrometry

  • Vesicular trafficking: Examine lysosomal function and protein secretion using fluorescent markers

  • Cell-specific phenotypes: Depending on the cell type, measure parameters like insulin secretion (pancreatic β-cells) or immunological responses (immune cells)

Pharmacological Approaches:

  • Use selective ENTPD inhibitors with appropriate controls

  • Compare effects with other ENTPD family inhibitors to distinguish specific ENTPD4 functions

  • Rescue experiments with nucleotide supplementation to confirm mechanism

For comprehensive functional characterization, combine multiple approaches and include proper controls to distinguish ENTPD4-specific effects from potential compensatory mechanisms by other ENTPD family members .

  • How can I troubleshoot low enzymatic activity of recombinant ENTPD4?

When encountering low enzymatic activity with recombinant ENTPD4, systematic troubleshooting should address several potential issues:

Problem AreaPotential IssuesTroubleshooting Approach
Buffer ConditionsSuboptimal pHTest activity across pH range 4.5-7.5; ENTPD4 requires acidic pH (5.5-6.5)
Insufficient calciumEnsure 1-5 mM CaCl₂ is present; test different concentrations
Presence of inhibitorsCheck for EDTA, excessive phosphate, or other chelating agents
Protein QualityDenaturationVerify protein folding using circular dichroism or thermal shift assays
Improper glycosylationConfirm expression system provides appropriate post-translational modifications
AggregationPerform size exclusion chromatography to assess monodispersity
Assay ComponentsSubstrate degradationUse fresh substrate preparations; store concentrated stocks at -80°C
Detection system issuesInclude positive controls (e.g., commercial phosphatase) to validate detection
Enzyme concentrationOptimize enzyme concentration; too high or low can affect results
Technical ExecutionIncubation timeExtend incubation time for low activity samples
TemperatureVerify incubator temperature accuracy
Inhibitory contaminantsTest for potential inhibitors in sample or reaction components

If activity remains low after addressing these factors, consider testing alternative constructs (e.g., different truncations or tags) or expression systems, as protein architecture significantly impacts enzymatic function. For carrier-free preparations, adding BSA (0.1-1%) to storage buffers (not reaction buffers) may help stabilize the protein during storage and prevent activity loss through surface adsorption .

  • What data normalization strategies are most appropriate for ENTPD4 expression studies?

Proper data normalization is critical for accurate interpretation of ENTPD4 expression studies. Based on best practices in gene expression analysis, the following strategies are recommended:

For qPCR-Based Expression Analysis:

  • Multiple reference gene normalization: As single housekeeping genes like GAPDH and ACTB have shown variable expression under different conditions, use at least 2-3 validated reference genes selected for stability in your specific experimental system. Calculate normalization factors using geometric averaging of multiple references through algorithms like geNorm .

  • Sample quality normalization: Include RNA integrity values (RIN) as covariates in analysis when working with potentially degraded samples.

  • Inter-run calibration: When analyzing ENTPD4 expression across multiple qPCR runs, include inter-run calibrators (identical samples present on all plates) to correct for run-to-run variation.

For Protein-Level Studies:

  • Total protein normalization: Use total protein staining methods (REVERT, Ponceau S) rather than single housekeeping proteins for Western blot normalization.

  • Subcellular fraction controls: When examining ENTPD4 in specific cellular fractions (e.g., lysosomes), normalize to compartment-specific markers rather than whole-cell references.

  • Enzymatic activity normalization: For functional studies, normalize ENTPD4 enzymatic activity to protein concentration determined by quantitative methods like BCA assay rather than semi-quantitative measures.

These normalization approaches provide more reliable quantification of ENTPD4 expression levels across different experimental conditions and biological systems, reducing technical variability and allowing detection of true biological differences .

  • How can I distinguish between ENTPD4 and other ENTPD family members in complex biological samples?

Distinguishing ENTPD4 from other ENTPD family members in complex biological samples requires selective approaches targeting the unique properties of ENTPD4:

Biochemical Approaches:

  • pH-dependent activity profiling: Conduct enzymatic assays at multiple pH points (pH 5.0, 6.0, 7.0, 8.0). ENTPD4 shows maximal activity at acidic pH (~5.5-6.5), while ENTPD1, 2, and 3 are most active at neutral to alkaline pH.

  • Substrate selectivity analysis: Compare hydrolysis rates of different nucleotides (ATP, ADP, UTP, UDP). ENTPD4 preferentially hydrolyzes UDP, while ENTPD3 has broader specificity for ATP, ADP, UTP, and UDP .

  • Subcellular fractionation: Separate cellular components (plasma membrane, lysosomes, endoplasmic reticulum) before analysis, as ENTPD4 predominantly localizes to intracellular vesicular compartments rather than the cell surface.

Molecular Approaches:

  • Specific antibody detection: Use validated antibodies with confirmed specificity for ENTPD4 epitopes that do not cross-react with other family members. Verify specificity using knockout/knockdown controls.

  • Targeted proteomics: Develop selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) mass spectrometry assays targeting unique ENTPD4 peptides.

  • Selective PCR amplification: Design primers targeting unique regions of the ENTPD4 transcript with no significant homology to other family members. Confirm specificity through sequencing of amplicons.

Using a combination of these approaches will provide more reliable identification and quantification of ENTPD4-specific contributions in complex biological systems where multiple ENTPD family members may be present .

Data Analysis and Interpretation

  • How should I interpret changes in ENTPD4 expression in disease models?

Interpreting changes in ENTPD4 expression in disease models requires careful consideration of its biological functions and cellular context:

Contextual Analysis Framework:

  • Cellular localization context: Unlike ectoenzymes like ENTPD1-3, ENTPD4's primary localization to lysosomes and secretory vesicles suggests its altered expression may impact intracellular processes rather than extracellular purinergic signaling.

  • Tissue-specific considerations: Interpret changes in the context of tissue-specific functions:

    • In pancreatic β-cells: Consider impacts on insulin granule processing and secretion

    • In immune cells: Evaluate effects on lysosomal function and antigen processing

    • In neurons: Assess potential effects on neurotransmitter vesicle loading

  • Pathway integration: Connect ENTPD4 expression changes to broader nucleotide metabolism and glycosylation pathways rather than viewing in isolation.

Analytical Approaches:

  • Correlation analysis: Examine correlations between ENTPD4 expression and:

    • Disease severity markers

    • Expression of functionally related genes (other ENTPDs, nucleotide transporters)

    • Relevant clinical parameters

  • Multi-omics integration: Combine transcriptomic data on ENTPD4 expression with:

    • Proteomic data on ENTPD4 protein levels

    • Metabolomic data on nucleotide profiles

    • Glycomic data on protein glycosylation patterns

  • Validation through intervention: Confirm the significance of observed expression changes through:

    • Genetic modulation of ENTPD4 in disease models

    • Pharmacological targeting of ENTPD4 activity

    • Rescue experiments restoring normal ENTPD4 expression/activity

This comprehensive approach helps distinguish between causative roles of ENTPD4 dysregulation in disease pathogenesis versus compensatory responses to altered cellular states .

  • What are the best approaches for studying ENTPD4 in single-cell analyses?

Single-cell analysis of ENTPD4 presents unique challenges due to low abundance transcripts and protein heterogeneity. Based on best practices in single-cell studies, the following approaches are recommended:

Single-Cell Transcriptomics:

  • Protocol optimization: For low-abundance transcripts like ENTPD4, use protocols with higher sequencing depth rather than maximizing cell numbers.

  • Targeted preamplification: Before single-cell RNA-seq, consider targeted preamplification of ENTPD4 and related genes of interest to enhance detection sensitivity.

  • Computational analysis:

    • Use specialized algorithms for imputation of dropout events

    • Implement trajectory analysis to identify cellular states where ENTPD4 is dynamically regulated

    • Apply module scoring to place ENTPD4 in functional gene networks

Single-Cell Protein Analysis:

  • Multiplexed immunofluorescence: Combine ENTPD4 staining with markers for subcellular compartments (LAMP1 for lysosomes) and cell type-specific markers.

  • Mass cytometry (CyTOF): Develop metal-conjugated antibodies against ENTPD4 for inclusion in CyTOF panels, allowing simultaneous detection of dozens of protein markers.

  • Enzyme activity in single cells: Adapt UDP hydrolysis assays using fluorescent substrates compatible with flow cytometry or imaging platforms.

Single-Cell Multi-Omics:
For comprehensive characterization, consider emerging methods that combine:

  • CITE-seq: Simultaneously measure ENTPD4 transcript and surface protein markers

  • TEA-seq: Triple-omics approach measuring transcriptome, epitopes, and chromatin accessibility

When working with limited samples or low abundance targets, implementing two-step RT-qPCR protocols and preamplification of RNA or first-strand cDNA can significantly increase the amount of detectable target, which is particularly valuable for single-cell analysis of ENTPD4 .

Advanced Applications

  • How can ENTPD4 be used as a target for therapeutic development?

ENTPD4's unique properties present several opportunities for therapeutic targeting, particularly in disease contexts where nucleotide metabolism or glycosylation processes are dysregulated:

Target Validation Approaches:

  • Disease association studies: Comprehensive analysis of ENTPD4 expression, genetic variants, and activity across disease cohorts to identify conditions where ENTPD4 modulation may be therapeutic.

  • Genetic validation: Use of CRISPR/Cas9 or conditional knockout models to establish causality between ENTPD4 function and disease phenotypes.

  • Chemical probe development: Creation of selective ENTPD4 inhibitors to serve as tool compounds for target validation before therapeutic development.

Therapeutic Strategies:

  • Small molecule inhibitors: Development of acid-stable, selective inhibitors targeting ENTPD4's catalytic pocket, potentially utilizing the structural differences between ENTPD4 and other family members.

  • Allosteric modulators: Compounds targeting non-catalytic regulatory sites to modify ENTPD4 activity in a context-dependent manner.

  • Targeted protein degradation: PROTAC (Proteolysis Targeting Chimera) approaches to selectively degrade ENTPD4 protein in specific cell types.

  • Gene therapy approaches: For conditions associated with ENTPD4 deficiency, development of gene delivery systems targeting relevant cell types.

Therapeutic Applications:
Based on ENTPD4's functions, potential applications include:

  • Metabolic disorders: Targeting ENTPD4 to modulate glycosylation in diabetes or related conditions

  • Lysosomal storage diseases: Modifying ENTPD4 activity to influence lysosomal function

  • Immune disorders: Exploiting ENTPD4's role in antigen-presenting cells for immunomodulation

When developing therapeutic approaches, consider the predominantly intracellular localization of ENTPD4, which necessitates cell-permeable compounds or targeted delivery strategies to access the relevant cellular compartments .

  • What cutting-edge techniques are emerging for studying ENTPD4 structure-function relationships?

Several cutting-edge techniques are transforming our understanding of ENTPD4 structure-function relationships:

Structural Biology Approaches:

  • Cryo-electron microscopy (Cryo-EM): Enables visualization of ENTPD4 structure at near-atomic resolution without crystallization, particularly valuable for membrane-associated proteins like ENTPD4.

  • AlphaFold2 and related AI models: Provide computational predictions of ENTPD4 structure with increasing accuracy, allowing identification of critical domains and potential regulatory sites.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps protein dynamics and conformational changes in solution, revealing how ENTPD4 structure responds to different substrates or pH conditions.

  • Single-molecule FRET: Monitors real-time conformational changes during catalysis, providing insights into ENTPD4's enzymatic mechanism.

Functional Genomics Technologies:

  • Deep mutational scanning: Systematic creation and functional characterization of thousands of ENTPD4 variants to identify critical residues for activity and regulation.

  • Domain-focused CRISPR screening: Targeting specific structural elements of ENTPD4 to correlate structural features with cellular functions.

  • Proximity labeling proteomics (BioID, APEX): Identifies proteins interacting with ENTPD4 in its native cellular environment, revealing structural constraints and functional protein complexes.

Integrative Approaches:

  • Molecular dynamics simulations: Combine structural data with computational modeling to understand how ENTPD4 interacts with substrates and membrane environments.

  • Structure-guided activity-based probes: Design of chemical probes that report on specific conformational states of ENTPD4 in cells.

  • In situ structural biology: Emerging techniques like cryo-electron tomography to visualize ENTPD4 structure directly within cellular compartments.

These advanced techniques are providing unprecedented insights into how ENTPD4's structure determines its catalytic properties, regulation, and cellular functions, opening new avenues for both basic research and therapeutic targeting .

  • How can I design experiments to investigate the role of ENTPD4 in cross-talk between nucleotide metabolism and other cellular pathways?

Investigating ENTPD4's role in pathway cross-talk requires multifaceted experimental approaches that capture the complexity of interconnected cellular processes:

Metabolic Flux Analysis:

  • Stable isotope tracing: Use 13C/15N-labeled nucleotides to track metabolic fates in ENTPD4-manipulated cells, revealing connections to glycolysis, pentose phosphate pathway, and pyrimidine metabolism.

  • Targeted metabolomics: Quantify changes in UDP-sugars and related metabolites to understand how ENTPD4 activity influences glycosylation substrate availability.

  • Temporal metabolite profiling: Capture dynamic metabolic responses to ENTPD4 inhibition or activation over time to identify primary versus secondary effects.

Integrated Multi-Omics:

  • Sequential experimental design:

    • Generate matched samples for transcriptomics, proteomics, phosphoproteomics, and metabolomics

    • Manipulate ENTPD4 through genetic or pharmacological approaches

    • Apply network analysis to identify pathways most affected by ENTPD4 perturbation

  • Perturbation-response experiments: Systematically challenge ENTPD4-modified cells with stressors or pathway activators to reveal conditional dependencies.

  • Organelle-specific analysis: Isolate lysosomes, Golgi, and other relevant compartments to localize ENTPD4's effects to specific subcellular domains.

Functional Readouts:

  • Glycosylation profiling: Use lectin arrays or mass spectrometry to assess how ENTPD4 manipulation affects protein glycosylation patterns.

  • Calcium signaling: Monitor intracellular calcium dynamics, as nucleotide signaling often intersects with calcium-dependent pathways.

  • Vesicular trafficking: Track lysosomal function and protein secretion with fluorescent reporters to connect ENTPD4 activity to membrane trafficking networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.