Recombinant Human Ectonucleoside triphosphate diphosphohydrolase 7 (ENTPD7)

Shipped with Ice Packs
In Stock

Description

Introduction

Ectonucleoside triphosphate diphosphohydrolase 7 (ENTPD7), also known as ecto-nucleoside triphosphate diphosphohydrolase 7, is an enzyme that, in humans, is encoded by the ENTPD7 gene . ENTPD7 belongs to the ectonucleoside triphosphate diphosphohydrolase (ENTPDase) family, which are responsible for catalyzing the hydrolysis of nucleoside triphosphates and diphosphates in a calcium- or magnesium-dependent manner .

Function and Mechanism

ENTPD7, an enzyme expressed in epithelial cells in the small intestine, modulates the level of extracellular ATP (eATP) . It preferentially hydrolyzes nucleoside diphosphates and triphosphates . By controlling eATP levels, ENTPD7 regulates T cell responses, including Th17 cell induction .

Role in Immune Regulation

ENTPD7 plays a crucial role in modulating immune responses in the small intestine . Studies involving mice with targeted deletion of the Entpd7 gene revealed increased ATP levels in the small intestinal lumen, leading to a selective increase in the number of Th17 cells in the small intestinal lamina propria . This increase was diminished upon oral administration of antibiotics or ATP antagonists, suggesting that commensal microbiota-dependent ATP release mediates Th17 cell development in the absence of ENTPD7 .

The absence of ENTPD7 can lead to severe experimental autoimmune encephalomyelitis, resulting from an accumulation of IL-17 and IFN-γ . Conversely, Entpd7 -/- mice have demonstrated resistance to Citrobacter rodentium infection .

ENTPD7 and Inflammation

ENTPD7's expression in the epithelial cells of the small intestine is crucial for controlling luminal ATP levels, thereby regulating Th17-cell development . High ATP levels and Th17-cell accumulation have been observed in the lamina propria of Entpd7 -/- mice, a condition that can be restored by administering ATP antagonists or antibiotics orally . The release of eATP, dependent on commensal microbiota, supports Th17-cell development when ENTPD7 is absent .

Genetic and Environmental Influences on ENTPD7 Expression

The expression of the ENTPD7 gene can be influenced by various factors. Studies in rats indicate that exposure to certain substances can alter ENTPD7 mRNA expression :

SubstanceEffect on ENTPD7 mRNA Expression
Titanium dioxideIncreased
FormaldehydeDecreased/Increased
GentamicinDecreased
LeflunomideDecreased
MetforminIncreased
MethotrexateIncreased
MethylisothiazolinoneIncreased
Nickel atomIncreased
Ozone co-treated with SootIncreased
Perfluorononanoic acidDecreased
Perfluorooctanoic acidIncreased

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ENTPD7; LALP1; Ectonucleoside triphosphate diphosphohydrolase 7; NTPDase 7; Lysosomal apyrase-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-604
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ENTPD7
Target Protein Sequence
MARISFSYLCPASWYFTVPTVSPFLRQRVAFLGLFFISCLLLLMLIIDFRHWSASLPRDR QYERYLARVGELEATDTEDPNLNYGLVVDCGSSGSRIFVYFWPRHNGNPHDLLDIKQMRD RNSQPVVKKIKPGISAMADTPEHASDYLRPLLSFAAAHVPVKKHKETPLYILCTAGMRLL PERKQLAILADLVKDLPLEFDFLFSQSQAEVISGKQEGVYAWIGINFVLGRFDHEDESDA EATQELAAGRRRTVGILDMGGASLQIAYEVPTSTSVLPAKQEEAAKILLAEFNLGCDVQH TEHVYRVYVTTFLGFGGNFARQRYEDLVLNETLNKNRLLGQKTGLSPDNPFLDPCLPVGL TDVVERNSQVLHVRGRGDWVSCGAMLSPLLARSNTSQASLNGIYQSPIDFNNSEFYGFSE FFYCTEDVLRIGGRYHGPTFAKAAQDYCGMAWSVLTQRFKNGLFSSHADEHRLKYQCFKS AWMYQVLHEGFHFPYDYPNLRTAQLVYDREVQWTLGAILYKTRFLPLRDLRQEGVRQAHG SWFRLSFVYNHYLFFACILVVLLAIFLYLLRLRRIHHRQTRASAPLDLLWLEEVVPMMGV QVGP
Uniprot No.

Target Background

Function

Recombinant Human Ectonucleoside triphosphate diphosphohydrolase 7 (ENTPD7) catalyzes the hydrolysis of nucleoside triphosphates and diphosphates in a calcium- or magnesium-dependent manner. It exhibits preferential hydrolysis of nucleoside 5'-triphosphates, with substrate preference in the order UTP > GTP > CTP. ATP and nucleoside diphosphates are hydrolyzed to a significantly lesser extent.

Database Links

HGNC: 19745

OMIM: 616753

KEGG: hsa:57089

STRING: 9606.ENSP00000359520

UniGene: Hs.28326

Protein Families
GDA1/CD39 NTPase family
Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein.

Q&A

What is Ectonucleoside Triphosphate Diphosphohydrolase 7 and what family does it belong to?

Ectonucleoside Triphosphate Diphosphohydrolase 7 (ENTPD7), also known as Lysosomal apyrase-like protein 1 (LALP1), belongs to the GDA1/CD39 NTPase family of ectoenzymes. These enzymes are responsible for hydrolyzing extracellular nucleotides and play crucial roles in regulating purinergic signaling pathways. ENTPD7 specifically is an endo-apyrase with substrate preference for nucleoside triphosphates, particularly UTP, GTP, and CTP . Unlike some other family members that are expressed on cell surfaces, ENTPD7 is entirely intracellularly located and faces the lumen of cytoplasmic organelles . The protein shares considerable homology with hLALP70, another mammalian lysosomal endo-apyrase, indicating evolutionary conservation of this enzymatic function across mammals.

How does ENTPD7 differ from other ectonucleotidases in the NTPDase family?

ENTPD7 differs from other NTPDases primarily in its cellular localization, substrate specificity, and tissue distribution. While NTPDases 1, 2, 3, and 8 are located on the cell surface, and NTPDases 5 and 6 are localized within cells but can undergo secretion after heterologous expression, ENTPD7 (along with NTPDase4) is entirely intracellularly located and faces the lumen of cytoplasmic organelles . This distinct localization suggests specialized functions compared to cell-surface NTPDases that directly interact with extracellular nucleotides.

Regarding substrate preference, ENTPD7 shows higher hydrolytic activity toward UTP, GTP, and CTP compared to other nucleoside triphosphates . This contrasts with other family members that may have different nucleotide preferences. Additionally, while many NTPDases require Ca²⁺ or Mg²⁺ ions for activity (particularly the cell-surface subtypes), the ion requirements for ENTPD7 activity reflect its intracellular environment.

ENTPD7 is preferentially expressed in epithelial cells of the small intestine, whereas other NTPDases show different tissue distribution patterns . For example, NTPDase1 is predominantly expressed in vasculature and immune cells, highlighting the specialized roles of different family members in tissue-specific functions.

Where is ENTPD7 primarily expressed in the body?

ENTPD7 exhibits a tissue-specific expression pattern, being preferentially expressed in epithelial cells of the small intestine . This localization is significant as it suggests ENTPD7 plays specialized roles in intestinal physiology and immunity. Studies using targeted deletion of the Entpd7 gene in mice have demonstrated that ENTPD7 is critical for regulating ATP levels in the small intestinal lumen, which in turn affects immune cell populations in the gut, particularly Th17 cells .

The expression of ENTPD7 can be detected using techniques such as quantitative PCR with specific primers (5′-CCCCTTTACATCCTCTGCAC-3′ and 5′-GTCAAACTCCAACGGCAAAT-3′) . Immunohistochemical analysis of intestinal tissues can also confirm expression patterns, typically using antibodies specific to ENTPD7 or epithelial cell markers like cytokeratin to co-localize expression.

What is the genomic organization of the human ENTPD7 gene?

The human ENTPD7 gene resides on chromosome 10q23-q24 and has a well-characterized genomic structure. The gene contains 12 exons and 11 introns spanning approximately 46 kilobase pairs . This genomic organization is important for understanding the regulation of ENTPD7 expression and for designing genetic studies such as knockout models.

The human ENTPD7 gene encodes a 604-amino acid protein, while the mouse ortholog (Entpd7) encodes a slightly larger 606-amino acid protein . Both proteins share significant sequence homology, indicating evolutionary conservation of function. The gene is represented in genomic databases with specific accession numbers: for human ENTPD7, the gene symbol is ENTPD7 with gene accession number NM_020354 and protein accession number AF269255 .

Understanding the genomic structure is essential for researchers designing genetic modification experiments, expression studies, or investigating polymorphisms that might affect ENTPD7 function in different populations.

How can researchers measure ENTPD7 enzymatic activity in experimental settings?

Measuring ENTPD7 enzymatic activity requires specific methodological approaches due to its intracellular localization and substrate preferences. A validated protocol involves isolating crude membrane fractions from cells expressing ENTPD7, followed by enzymatic assays to measure nucleotide hydrolysis.

Methodological approach:

  • Isolate and homogenize cells expressing ENTPD7 (e.g., intestinal epithelial cells).

  • Remove nuclei and separate the crude membrane fraction from cytosol by ultracentrifugation (100,000 × g for 30 min).

  • Suspend the membrane fraction (containing ~10 μg total protein) in reaction buffer (20 mM HEPES [pH 7.4], 120 mM NaCl, 5 mM KCl, 0.2 mM EDTA, 1 mM NaN₃, and 0.5 mM Na₃VO₄, with or without 5 mM CaCl₂).

  • Pre-incubate for 5 min at 37°C, then add reaction buffer containing 10 mM NTP (UTP, GTP, or CTP) and incubate for 30 min.

  • Determine NTP hydrolyzing activity by measuring released inorganic phosphate .

This assay allows researchers to quantify ENTPD7's nucleotide hydrolyzing capacity and compare activity levels between wild-type and mutant proteins or between different experimental conditions. Control reactions without enzyme or with heat-inactivated enzyme should be included to establish baseline measurements.

What role does ENTPD7 play in intestinal immunity?

ENTPD7 serves as a critical regulator of intestinal immunity by controlling extracellular ATP levels in the small intestinal lumen. ATP acts as a damage-associated molecular pattern (DAMP) that can stimulate purinergic receptors and influence immune cell responses. ENTPD7, expressed by intestinal epithelial cells, helps maintain appropriate ATP concentrations in the intestinal environment.

Research using Entpd7-deficient (Entpd7⁻/⁻) mice has demonstrated that ENTPD7 deletion results in increased ATP levels in the small intestinal lumen . This elevation in ATP concentration leads to a selective increase in the number of Th17 cells in the small intestinal lamina propria. The mechanism appears to involve commensal microbiota-dependent ATP release, as treatment with oral antibiotics or ATP antagonists decreased Th17 cell numbers in Entpd7⁻/⁻ mice .

The immunomodulatory function of ENTPD7 differs from that of ENTPDase1/CD39, which is expressed in immune cells and has been more extensively studied. While both enzymes regulate ATP levels, their different cellular and tissue distributions suggest specialized roles in distinct compartments of the immune system.

How does ENTPD7 influence susceptibility to intestinal pathogens?

ENTPD7 significantly impacts host defense against intestinal pathogens through its regulation of Th17 cell development. Th17 cells produce IL-17, which plays a crucial role in mucosal immunity against extracellular bacteria.

Experimental evidence from Entpd7⁻/⁻ mice shows that these animals are more resistant to oral infection with Citrobacter rodentium, a model pathogen used to study intestinal infections . This enhanced resistance correlates with the increased number of Th17 cells in the small intestinal lamina propria of these mice. The protective effect is likely mediated by enhanced IL-17 production, which stimulates antimicrobial peptide secretion by epithelial cells and promotes neutrophil recruitment to combat the infection.

This finding has significant implications for understanding how nucleotide metabolism in the intestinal environment influences host-pathogen interactions. Researchers studying intestinal infections may consider ENTPD7 as a potential therapeutic target for enhancing mucosal immunity against specific pathogens.

What is the connection between ENTPD7 and autoimmune conditions?

While ENTPD7's role in enhancing mucosal immunity can be beneficial for pathogen clearance, it may also contribute to pathological inflammation in certain contexts. Research has shown that Entpd7⁻/⁻ mice suffered from more severe experimental autoimmune encephalomyelitis (EAE), a model for multiple sclerosis .

The exacerbated EAE in Entpd7⁻/⁻ mice was associated with increased numbers of CD4⁺ T cells producing both IL-17 and IFN-γ . This suggests that the dysregulation of ATP levels caused by ENTPD7 deficiency can promote the development of inflammatory T cell subsets that contribute to autoimmune pathology.

This connection between ENTPD7 and autoimmunity highlights the delicate balance of nucleotide metabolism in immune regulation. Targeting ENTPD7 activity might therefore have therapeutic potential in both enhancing immunity against pathogens and modulating autoimmune responses, depending on the specific clinical context.

How can researchers generate and validate ENTPD7 knockout models?

Generating ENTPD7 knockout models requires careful genetic engineering approaches. A validated methodology involves:

  • Design of targeting vector: Create a targeting vector containing Entpd7 genomic fragments flanking a neomycin resistance gene cassette. Include a gene encoding HSV thymidine kinase driven by a phosphoglycerate kinase promoter for negative selection.

  • Embryonic stem cell transfection: Transfect the targeting vector into embryonic stem cells (such as V6.5 ES cells), and select G418 and ganciclovir double-resistant colonies.

  • Screening for homologous recombination: Use PCR and Southern blot analysis to identify colonies with successful homologous recombination events.

  • Blastocyst injection: Microinject homologous recombinants into blastocysts (e.g., from C57BL/6 mice) and implant into pseudopregnant females.

  • Breeding strategy: Intercross heterozygous F1 progeny to obtain homozygous knockout mice, then confirm genotypes by Southern blot and phenotypes by Northern blot analysis .

  • Backcrossing: For more consistent genetic background, backcross the knockout line to a desired strain (e.g., C57BL/6) for at least 4-6 generations .

Validation of knockout models should include confirmation of gene deletion at both DNA and RNA levels, as well as functional assays to demonstrate the absence of ENTPD7 enzymatic activity in target tissues.

What cell line models are available for studying ENTPD7 function?

Intestinal epithelial cell lines represent valuable tools for studying ENTPD7 function in a controlled environment. Researchers have successfully established ENTPD7-expressing and ENTPD7-deficient intestinal epithelial cell lines using the following approach:

  • Source animals: Use H-2Kb-tsA58-transgenic mice, which carry a temperature-sensitive SV40 large T antigen that enables conditional immortalization of cells.

  • Crossbreeding: Cross these mice with wild-type or Entpd7⁻/⁻ mice to generate animals from which cell lines can be derived.

  • Cell isolation: Isolate small intestinal epithelial cells using established protocols and culture them at 33°C (permissive temperature for the temperature-sensitive SV40 large T antigen).

  • Verification: Confirm epithelial identity by immunostaining for cytokeratin and other epithelial markers using antibodies and visualization with DAB chromogen .

These cell lines enable comparative studies between wild-type and ENTPD7-deficient cells, allowing researchers to investigate the molecular mechanisms underlying ENTPD7's functions in a simplified system. They can be particularly useful for studying enzyme kinetics, subcellular localization, protein-protein interactions, and responses to various stimuli or inhibitors.

Which compounds affect ENTPD7 expression?

Multiple compounds have been shown to modulate ENTPD7 expression, suggesting complex regulatory mechanisms. Based on gene-chemical interaction annotations, the following compounds affect ENTPD7 expression:

Compounds that increase ENTPD7 expression:

  • 17β-estradiol

  • 1,1-dichloroethene (vinylidene chloride)

  • 2,3',4,4',5-Pentachlorobiphenyl

  • 2-hydroxypropanoic acid (lactic acid)

  • 4,4'-sulfonyldiphenol (bisphenol S)

  • All-trans-retinoic acid (tretinoin)

  • Arsenic compounds (sodium arsenite)

Compounds that decrease ENTPD7 expression or affect other parameters:

  • 4-hydroxyphenyl retinamide (fenretinide) - both increases and decreases reported

  • Aflatoxin B1 - decreases methylation of ENTPD7

These chemical interaction data provide insights into potential regulatory mechanisms for ENTPD7 expression and suggest environmental or pharmacological factors that might influence its biological activities. Researchers studying ENTPD7 regulation should consider these compounds when designing experiments or interpreting results from different experimental conditions.

How can recombinant ENTPD7 be produced for research applications?

Production of recombinant ENTPD7 requires careful consideration of its structural features and enzymatic properties. While specific protocols for ENTPD7 production are not detailed in the provided search results, a general methodological approach based on similar enzymes would include:

  • Expression system selection: Choose an appropriate expression system that can handle mammalian proteins with post-translational modifications. Common options include:

    • Mammalian expression systems (HEK293, CHO cells)

    • Insect cell systems (Sf9, High Five cells with baculovirus vectors)

    • Yeast systems (Pichia pastoris)

  • Vector design: Create an expression construct containing:

    • The full human ENTPD7 coding sequence (604 amino acids)

    • Appropriate secretion signals if extracellular production is desired

    • Affinity tags (His, FLAG, etc.) for purification

    • Protease cleavage sites to remove tags if needed

  • Expression optimization: Adjust culture conditions (temperature, induction time, media composition) to maximize yield while maintaining proper folding and activity.

  • Purification strategy: Implement multi-step purification using:

    • Affinity chromatography (based on incorporated tags)

    • Ion exchange chromatography

    • Size exclusion chromatography

  • Activity validation: Confirm enzymatic activity of the purified protein using the NTP hydrolysis assay described earlier, with comparison to native enzyme activity levels.

Researchers should be aware that ENTPD7's intracellular localization may present challenges for recombinant expression, as the protein may require specific conditions to maintain its native conformation and activity. Careful optimization of expression and purification conditions is essential for obtaining functionally active recombinant ENTPD7.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.