Recombinant Human Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 (ENPP5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes if needed. We will accommodate requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
ENPP5; UNQ550/PRO1107; Ectonucleotide pyrophosphatase/phosphodiesterase family member 5; E-NPP 5; NPP-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-477
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
ENPP5
Target Protein Sequence
PDQQKVLLVSFDGFRWDYLYKVPTPHFHYIMKYGVHVKQVTNVFITKTYPNHYTLVTGLF AENHGIVANDMFDPIRNKSFSLDHMNIYDSKFWEEATPIWITNQRAGHTSGAAMWPGTDV KIHKRFPTHYMPYNESVSFEDRVAKIIEWFTSKEPINLGLLYWEDPDDMGHHLGPDSPLM GPVISDIDKKLGYLIQMLKKAKLWNTLNLIITSDHGMTQCSEERLIELDQYLDKDHYTLI DQSPVAAILPKEGKFDEVYEALTHAHPNLTVYKKEDVPERWHYKYNSRIQPIIAVADEGW HILQNKSDDFLLGNHGYDNALADMHPIFLAHGPAFRKNFSKEAMNSTDLYPLLCHLLNIT AMPHNGSFWNVQDLLNSAMPRVVPYTQSTILLPGSVKPAEYDQEGSYPYFIGVSLGSIIV IVFFVIFIKHLIHSQIPALQDMHAEIAQPLLQA
Uniprot No.

Target Background

Function
Recombinant Human Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 (ENPP5) hydrolyzes NAD but not nucleotide di- and triphosphates. It lacks lysopholipase D activity and may play a role in neuronal cell communication.
Gene References Into Functions
  1. ENPP5's ability to cleave nicotinamide adenine dinucleotide (NAD) suggests a potential role in NAD-based neurotransmission. PMID: 28898552
Database Links

HGNC: 13717

OMIM: 617001

KEGG: hsa:59084

STRING: 9606.ENSP00000230565

UniGene: Hs.35198

Protein Families
Nucleotide pyrophosphatase/phosphodiesterase family
Subcellular Location
Secreted. Membrane; Single-pass membrane protein.

Q&A

What is the structural composition of human ENPP5?

Mature human ENPP5 is an approximately 50 kDa protein consisting of a 407 amino acid extracellular region containing one phosphodiesterase/nucleotide pyrophosphatase domain, a 21 amino acid transmembrane segment, and a 25 amino acid cytoplasmic tail. The protein belongs to the nucleotide pyrophosphatase/phosphodiesterase family, which is a subgroup of a larger enzyme family that includes arylsulfatases, phosphopentomutases, 2,3-bisphosphoglycerate-independent phosphoglycerate mutases, and alkaline phosphatases . Human ENPP5 shares significant sequence homology with mouse and rat ENPP5, with approximately 85% amino acid sequence identity in the ectodomain .

How is recombinant human ENPP5 typically produced for research purposes?

Recombinant human ENPP5 is commonly expressed in mammalian expression systems such as HEK 293 cells to ensure proper protein folding and post-translational modifications. Commercial preparations typically consist of the extracellular domain (for example, Pro25-Ser430) with affinity tags such as a C-terminal 10-His tag to facilitate purification . The recombinant protein undergoes N-glycosylation during production, mimicking the natural post-translational modifications observed in vivo . Purification employs affinity chromatography followed by quality control assessments including purity verification by SDS-PAGE (>96% purity) and endotoxin testing (<1 EU/μg) .

What are the enzymatic characteristics of human ENPP5?

Human ENPP5 demonstrates specific substrate preferences and enzymatic activities:

SubstrateActivityNotes
NADCan hydrolyzeConfirmed activity
Nucleotide di- and triphosphatesCannot hydrolyzeDistinguishes it from other ENPP family members
O-(4-Nitrophenylphosphoryl) cholineExhibits phosphodiesterase activityValidated by R&D Systems testing

ENPP5 lacks lysopholipase D activity, which further differentiates it from other members of the ENPP family . Its enzymatic activity contributes to the regulation of extracellular nucleotide availability, thereby influencing various signaling cascades, particularly those mediated by P2Y receptors .

How can I establish a reliable assay to measure ENPP5 phosphodiesterase activity?

A reliable colorimetric phosphodiesterase activity assay for ENPP5 can be established using O-(4-Nitrophenylphosphoryl) choline as substrate. The following protocol has been validated:

  • Prepare assay buffer: 50 mM Sodium Acetate, 150 mM NaCl, pH 5.5

  • Dilute recombinant human ENPP5 to 5 μg/mL in assay buffer

  • Prepare substrate: Dilute O-(4-Nitrophenylphosphoryl) choline to 2 mM in assay buffer from a 500 mM stock solution

  • Reaction setup: Load 50 μL of diluted ENPP5 (5 μg/mL) in a clear 96-well plate

  • Initiate reaction by adding 50 μL of 2 mM substrate (include substrate blank controls)

  • Incubate the sealed plate at room temperature for 30 minutes

  • Stop the reaction by adding 100 μL of 0.2 M NaOH to each well

  • Measure absorbance at 410 nm in endpoint mode

  • Calculate specific activity using the formula:

Specific Activity (pmol/min/μg)=Adjusted Absorbance (OD)×Conversion Factor (pmol/OD)Incubation time (min)×amount of enzyme (μg)\text{Specific Activity (pmol/min/μg)} = \frac{\text{Adjusted Absorbance (OD)} \times \text{Conversion Factor (pmol/OD)}}{\text{Incubation time (min)} \times \text{amount of enzyme (μg)}}

This assay allows for standardized measurement of ENPP5 activity across experimental conditions .

What are the critical parameters that affect ENPP5 enzymatic activity in vitro?

Several parameters significantly influence ENPP5 enzymatic activity:

  • pH Optimum: ENPP5 demonstrates optimal activity at pH 5.5, which differs from the physiological pH of most extracellular environments. This suggests potential compartmentalization of activity in acidified microenvironments in vivo .

  • Divalent Cations: The enzyme's activity depends on the presence of specific divalent cations, with differential effects observed:

    • Mg²⁺ stabilizes the active site and enhances catalytic efficiency

    • Ca²⁺ can modulate substrate binding affinity

    • Zn²⁺ is essential for the catalytic mechanism

  • Temperature Sensitivity: ENPP5 activity decreases significantly at temperatures above 37°C, with notable instability observed at 42°C and above.

  • Buffer Composition: Ionic strength affects enzyme-substrate interactions, with optimal activity observed in buffers containing 150-200 mM NaCl .

  • Substrate Concentration: Follows Michaelis-Menten kinetics with substrate inhibition observed at high concentrations of certain substrates.

When designing experiments to assess ENPP5 function, researchers should carefully control these parameters to ensure reproducible results.

How does ENPP5 interact with other components in nucleotide signaling pathways?

ENPP5 functions within a complex network of enzymes regulating extracellular nucleotides and associated signaling cascades. String database analysis identifies several predicted functional partners, including:

  • CSRNP3 (Cysteine/serine-rich nuclear protein 3): A transcriptional regulator with a predicted functional connection score of 0.495. This suggests ENPP5 may influence transcriptional responses, potentially through nucleotide-mediated signaling that affects CSRNP3 activity .

  • SPHKAP (A-kinase anchor protein SPHKAP): With a connection score of 0.471, this interaction suggests ENPP5 may function at the intersection of cAMP and sphingosine signaling pathways. SPHKAP anchors cAMP-dependent protein kinase (PKA type I) to specific subcellular compartments and regulates SPHK1, potentially linking ENPP5's nucleotide processing activity to sphingolipid metabolism .

  • RCAN2 (Calcipressin-2): This protein inhibits calcineurin-dependent transcriptional responses and plays roles in central nervous system development. Its predicted interaction with ENPP5 (score 0.447) suggests potential involvement in neuronal signaling pathways .

  • PDGFD (Platelet-derived growth factor D): This growth factor functions in embryonic development, cell proliferation, migration, and survival. Its connection to ENPP5 (score 0.447) indicates possible roles for ENPP5 in modulating growth factor signaling or vice versa .

These predicted interactions provide research directions for investigating ENPP5's broader roles in cellular signaling beyond simple nucleotide hydrolysis.

What role might ENPP5 play in immune system regulation?

Recent research suggests ENPP5 may indirectly influence immune system functions through nucleotide regulation. A study by Mardjuki et al. identified the related protein ENPP3 as a major cyclic GMP-AMP (cGAMP) hydrolase and innate immune checkpoint . While this study focused on ENPP3, the functional similarity between ENPP family members suggests ENPP5 might also interact with immune signaling molecules.

ENPP5's ability to hydrolyze NAD but not nucleotide di- and triphosphates indicates a specialized role in processing specific immune-relevant metabolites . NAD serves as both a cofactor and signaling molecule, with extracellular NAD participating in immune cell activation and death. By regulating extracellular NAD levels, ENPP5 could modulate:

  • T-cell activation and ADP-ribosylation-dependent processes

  • NAD-dependent cell surface enzyme activities

  • Purinergic receptor signaling cascades

What experimental approaches can distinguish ENPP5 activity from other ENPP family members?

Distinguishing ENPP5 activity from other ENPP family members requires leveraging its unique substrate specificity profile. Consider these approaches:

  • Substrate Selection: Utilize ENPP5's ability to hydrolyze NAD while being unable to process nucleotide di- and triphosphates. A comparative assay with NAD, ATP, and ADP as substrates can distinguish ENPP5 from ENPP1-3, which readily hydrolyze ATP and ADP .

  • pH-Dependent Activity: Conduct enzyme assays across a pH range (5.0-8.0). ENPP5 shows optimal activity at acidic pH (approximately 5.5) , while other ENPP members often show broader pH optima.

  • Inhibitor Profile: Use selective inhibitors:

    • ENPP1 inhibitors (e.g., suramin) should not significantly affect ENPP5

    • Nucleotide analogs differentially inhibit ENPP family members

  • Immunological Approaches: Employ specific antibodies for:

    • Immunodepletion studies

    • Activity neutralization assays

    • Western blotting to confirm protein identity

  • Expression Systems: When studying complex samples, consider using CRISPR-Cas9 to generate ENPP5-specific knockouts for comparative analysis.

A combination of these approaches provides more reliable differentiation than any single method.

How can I effectively validate ENPP5 knockout or knockdown models?

Comprehensive validation of ENPP5 genetic manipulation models requires multi-level assessment:

  • Genomic Validation:

    • PCR-based genotyping to confirm targeted modifications

    • Sequencing to verify exact mutations in the ENPP5 gene

  • Transcript Analysis:

    • RT-qPCR to quantify ENPP5 mRNA levels

    • RNA-seq to assess global transcriptional changes and potential compensatory mechanisms

  • Protein Validation:

    • Western blotting using specific anti-ENPP5 antibodies

    • Immunohistochemistry/immunofluorescence to verify tissue-specific expression changes

  • Functional Assessment:

    • Enzymatic activity assays using O-(4-Nitrophenylphosphoryl) choline as a substrate

    • NAD hydrolysis measurements in cellular extracts or conditioned media

  • Phenotypic Characterization:

    • Cell-based assays relevant to neuronal communication (for cellular models)

    • Assessment of P2Y receptor-mediated signaling

    • Evaluation of tissue-specific phenotypes based on ENPP5's expression pattern

Complementation studies reintroducing wild-type ENPP5 should reverse observed phenotypes, confirming specificity of the genetic manipulation.

How might ENPP5's role in neuronal communication be experimentally investigated?

Investigating ENPP5's role in neuronal communication requires multi-faceted approaches:

  • Primary Neuronal Culture Models:

    • Manipulate ENPP5 expression levels through lentiviral transduction

    • Assess changes in:

      • Neuronal morphology (dendritic arborization, spine density)

      • Calcium signaling dynamics

      • Synaptic transmission using electrophysiology

  • Co-culture Systems:

    • Establish neuron-glia co-cultures with differential ENPP5 expression

    • Evaluate intercellular signaling through fluorescent nucleotide analogs

    • Investigate how ENPP5-mediated nucleotide processing affects glial-neuronal communication

  • Ex Vivo Slice Preparations:

    • Apply recombinant ENPP5 to brain slices

    • Measure changes in network activity through multi-electrode arrays

    • Perform pathway-specific optogenetic stimulation before and after ENPP5 application

  • In Vivo Approaches:

    • Generate conditional ENPP5 knockout models with neuron-specific Cre drivers

    • Assess behavioral phenotypes related to learning, memory, and neurological function

    • Utilize in vivo microdialysis to measure extracellular nucleotide levels

  • Molecular Interaction Studies:

    • Investigate predicted interactions with neuronal proteins like RCAN2, which plays roles in central nervous system development

    • Perform proximity labeling (BioID, APEX) to identify ENPP5 interaction partners in neuronal contexts

These approaches collectively would provide a comprehensive understanding of ENPP5's neuronal functions.

What is known about the post-translational regulation of ENPP5 activity?

Post-translational regulation of ENPP5 remains incompletely characterized, providing opportunities for novel research. Current knowledge suggests:

  • N-Glycosylation: ENPP5 undergoes N-glycosylation , which likely affects:

    • Protein folding and stability

    • Trafficking to the plasma membrane

    • Enzymatic activity and substrate recognition

  • Potential Phosphorylation: Bioinformatic analysis predicts multiple phosphorylation sites in the cytoplasmic tail and parts of the extracellular domain accessible to kinases. These may regulate:

    • Membrane localization

    • Protein-protein interactions

    • Catalytic activity

  • Proteolytic Processing: The mature form of human ENPP5 (approximately 50 kDa) suggests potential proteolytic processing from its full-length form . This processing might represent a regulatory mechanism controlling enzyme activity or localization.

  • Compartmentalization: ENPP5's optimal activity at acidic pH (5.5) suggests its function may be regulated through localization to specific cellular compartments with appropriate pH environments.

  • Protein-Protein Interactions: Predicted interactions with regulatory proteins like SPHKAP suggest potential complex formation that could modulate ENPP5 activity in response to signaling events.

Research opportunities exist to characterize these regulatory mechanisms and their physiological significance in various tissue contexts.

How conserved is ENPP5 across species, and what does this suggest about its evolutionary importance?

ENPP5 demonstrates significant conservation across mammalian species, with human ENPP5 sharing 85% amino acid sequence identity with mouse and rat ENPP5 in the ectodomain . This high degree of conservation suggests strong evolutionary pressure to maintain ENPP5's structure and function. Comparative analysis reveals:

  • Core Catalytic Domain: The phosphodiesterase/nucleotide pyrophosphatase domain shows the highest conservation, indicating the fundamental importance of enzymatic activity.

  • Transmembrane Region: Moderate conservation in the transmembrane segment suggests similar membrane topology and orientation across species.

  • Cytoplasmic Tail: More variable regions in the cytoplasmic domain may reflect species-specific regulatory mechanisms.

  • Substrate Specificity Determinants: Residues involved in substrate recognition, particularly those enabling NAD hydrolysis while preventing di- and triphosphate nucleotide processing, are highly conserved .

  • Tissue Expression Patterns: Expression data from the Mouse Genome Informatics database indicates ENPP5 expression across multiple tissues including the nervous system, suggesting conserved physiological roles .

This evolutionary conservation supports ENPP5's fundamental role in nucleotide metabolism and cellular signaling, likely with particular importance in neuronal systems where it may participate in conserved communication mechanisms.

How do the enzymatic properties of ENPP5 compare with other members of the ENPP family?

ENPP5 exhibits distinctive enzymatic properties compared to other ENPP family members:

ENPP MemberSubstrate SpecificityCellular LocalizationEnzymatic ActivityKnown Physiological Roles
ENPP1ATP, ADP, AP3A, AP4ACell surfaceNucleotide pyrophosphatase, phosphodiesteraseBone mineralization, insulin signaling
ENPP2 (Autotaxin)LysophosphatidylcholineSecretedLysophospholipase DCell motility, tumor metastasis
ENPP3ATP, ADP, cGAMPCell surfaceNucleotide pyrophosphataseImmune regulation, basophil function
ENPP4ATP, ADPCell surfaceNucleotide pyrophosphatasePlatelet aggregation
ENPP5NAD, O-(4-Nitrophenylphosphoryl) cholineCell surfacePhosphodiesteraseNeuronal communication
ENPP6GlycerophosphocholineSecreted, GPI-anchoredCholine-specific glycerophosphodiester phosphodiesteraseCholine metabolism
ENPP7SphingomyelinSecretedAlkaline sphingomyelinaseSphingolipid metabolism

Key distinguishing features of ENPP5 include:

  • Inability to hydrolyze nucleotide di- and triphosphates, unlike ENPP1-4

  • Lack of lysopholipase D activity, unlike ENPP2

  • Ability to hydrolyze NAD, suggesting a role in NAD-related signaling

  • Optimal activity at acidic pH (5.5)

These unique properties suggest ENPP5 evolved to fulfill specialized roles in nucleotide metabolism distinct from other family members, potentially in compartmentalized or tissue-specific contexts.

What are common challenges in working with recombinant ENPP5 and how can they be addressed?

Researchers working with recombinant ENPP5 may encounter several challenges:

  • Protein Stability Issues:

    • Challenge: Recombinant ENPP5 may show activity loss during storage or experimental manipulation.

    • Solution: Store at -80°C in small aliquots with 10-20% glycerol. Avoid freeze-thaw cycles. For working solutions, maintain at 4°C and use within 24 hours. Addition of stabilizing agents like BSA (0.1-0.5%) may improve stability.

  • Variable Enzymatic Activity:

    • Challenge: Inconsistent activity measurements between protein batches or experiments.

    • Solution: Always include positive controls and standard curves. Carefully control pH (5.5 is optimal) and buffer composition. Consider lot-to-lot variation in commercial preparations and standardize by specific activity rather than protein concentration.

  • Post-translational Modification Heterogeneity:

    • Challenge: N-glycosylation patterns may vary depending on expression systems .

    • Solution: For highest consistency, use the same expression system across studies. When comparing results from different sources, check glycosylation status using PNGase F treatment and SDS-PAGE mobility shifts.

  • Background Signal in Activity Assays:

    • Challenge: High background in colorimetric assays using O-(4-Nitrophenylphosphoryl) choline.

    • Solution: Include proper substrate blank controls . Consider using purified enzyme preparations rather than crude lysates. For cell-based assays, use ENPP5-knockout controls to establish specific signal.

  • Protein-Surface Interactions:

    • Challenge: Protein adsorption to laboratory plasticware causing activity loss.

    • Solution: Use low-binding tubes and plates. Add 0.01-0.05% non-ionic detergents (e.g., Triton X-100) or 0.1% BSA to buffers to minimize adsorption.

How can I design experiments to resolve conflicting data about ENPP5 function?

When faced with conflicting data regarding ENPP5 function, apply these systematic approaches:

  • Standardize Experimental Conditions:

    • Establish a common set of conditions for ENPP5 activity assays:

      • Buffer: 50 mM Sodium Acetate, 150 mM NaCl, pH 5.5

      • Temperature: 25°C (room temperature) for consistency

      • Substrate concentration: Determine and use substrate concentrations within linear range

    • Document all experimental variables comprehensively in publications

  • Cross-Validate with Multiple Methodologies:

    • Employ orthogonal techniques to assess the same function:

      • Colorimetric assays for enzymatic activity

      • Mass spectrometry to directly detect reaction products

      • Cellular assays to confirm physiological relevance

  • Control for Protein Quality and Specificity:

    • Characterize recombinant ENPP5 thoroughly:

      • SDS-PAGE for purity assessment (>96% is standard)

      • Western blotting with specific antibodies

      • Mass spectrometry to confirm protein identity

    • Use enzymatically inactive mutants as negative controls

  • Validate in Multiple Systems:

    • Test functions in:

      • Cell-free biochemical assays

      • Cellular overexpression systems

      • Knockout/knockdown models

      • In vivo models where possible

  • Address Biological Context Dependencies:

    • Evaluate ENPP5 function across different:

      • Cell/tissue types

      • Developmental stages

      • Physiological and pathological conditions

    • Consider interacting proteins that may modulate function

By systematically addressing these facets, researchers can resolve conflicting data and build consensus on ENPP5's true biological functions.

What are the most promising research directions for understanding ENPP5's physiological roles?

Several promising research directions emerge from current ENPP5 knowledge:

  • Neurobiological Functions:

    • Investigating ENPP5's role in synaptic transmission and plasticity

    • Exploring its contribution to neurodevelopmental processes

    • Examining potential implications in neurological disorders

    • Studying its interaction with RCAN2, which plays roles in central nervous system development

  • NAD Metabolism and Signaling:

    • Characterizing ENPP5's contribution to extracellular NAD homeostasis

    • Determining how ENPP5-mediated NAD hydrolysis affects NAD-dependent processes

    • Investigating cross-talk with other NAD-processing enzymes

    • Exploring implications for aging and metabolic regulation

  • Immune System Modulation:

    • Building on findings that related family member ENPP3 functions as a cGAMP hydrolase and immune checkpoint

    • Investigating ENPP5's potential immunomodulatory roles

    • Exploring therapeutic applications in immune-related disorders

  • Signaling Network Integration:

    • Validating and characterizing predicted interactions with SPHKAP, potentially linking cAMP and sphingosine signaling pathways

    • Investigating ENPP5's place in larger signaling networks

    • Developing systems biology approaches to model ENPP5's contribution to cellular homeostasis

  • Therapeutic Applications:

    • Developing specific ENPP5 modulators (inhibitors or activators)

    • Exploring recombinant ENPP5 as a potential therapeutic agent

    • Investigating ENPP5 as a biomarker for neurological or metabolic conditions

These directions leverage ENPP5's unique enzymatic properties, tissue distribution, and emerging understanding of its biological context.

What technological advances might facilitate deeper understanding of ENPP5 biology?

Emerging technologies offer new opportunities to advance ENPP5 research:

  • CRISPR-Based Approaches:

    • Base editing and prime editing for precise ENPP5 modifications

    • CRISPRi/CRISPRa for temporal control of ENPP5 expression

    • CRISPR screens to identify genes functionally linked to ENPP5

    • Tissue-specific conditional knockouts to dissect function in complex organisms

  • Advanced Imaging Technologies:

    • Live-cell biosensors for nucleotide metabolism

    • Super-resolution microscopy to visualize ENPP5 subcellular localization

    • Correlative light and electron microscopy (CLEM) to link ENPP5 localization with ultrastructural features

    • Fluorescence resonance energy transfer (FRET) sensors to detect ENPP5-substrate interactions

  • Proteomics and Interactomics:

    • Proximity labeling techniques (BioID, APEX) to comprehensively map ENPP5 interaction networks

    • Thermal proteome profiling to identify targets of ENPP5 modulators

    • Phosphoproteomics to elucidate ENPP5's impact on cellular signaling

    • Cross-linking mass spectrometry to capture transient interactions

  • Single-Cell Technologies:

    • Single-cell transcriptomics to identify cell populations with coordinated ENPP5 expression

    • Single-cell proteomics to correlate ENPP5 levels with cellular phenotypes

    • Spatial transcriptomics to map ENPP5 expression in tissue contexts

  • Computational and AI-Driven Approaches:

    • Molecular dynamics simulations to understand ENPP5 structural dynamics

    • Machine learning to predict novel ENPP5 substrates and interaction partners

    • Systems biology modeling to integrate ENPP5 into broader signaling networks

    • Virtual screening for development of selective ENPP5 modulators

These technological advances, combined with traditional biochemical and cell biological approaches, will enable a more comprehensive understanding of ENPP5's biological functions and therapeutic potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.