Recombinant Human Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 (ENPP7)

Shipped with Ice Packs
In Stock

Description

Physiological Roles and Tissue Distribution

ENPP7 is primarily expressed in the intestinal mucosa and human liver, with activity peaking in the jejunum . Its key functions include:

Sphingomyelin Digestion

ENPP7 hydrolyzes dietary sphingomyelin (SM) into ceramide and phosphocholine (PC) , a process critical for:

  • SM Absorption: Facilitates ceramide release, which inhibits cholesterol absorption by forming stable SM-cholesterol complexes .

  • Ceramide Signaling: Ceramide derivatives regulate cell proliferation, differentiation, and apoptosis .

Anti-Inflammatory and Anti-Cancer Effects

  • PAF Degradation: ENPP7 inactivates platelet-activating factor (PAF), a pro-inflammatory mediator, via phospholipase C-like activity .

  • Colon Cancer Prevention: Reduced ENPP7 activity is linked to colorectal adenocarcinomas; ceramide deficiency promotes tumorigenesis .

Tissue Localization

TissueExpression Pattern
Small IntestineHigh in jejunum, low in duodenum/colon; localized to microvillar membranes and Golgi
LiverSecreted into bile, enabling intestinal activity
FecesDetectable due to trypsin resistance and bile salt-dependent activation

Biochemical Properties and Enzymatic Activity

ENPP7 exhibits unique substrate specificity and regulatory mechanisms:

Substrates and Inhibitors

SubstrateActivityInhibitorsEffect
Sphingomyelin (SM)Hydrolyzes to ceramide + PC ATP, imidazole, orthovanadateDose-dependent inhibition
Palmitoyl lyso-PCPhospholipase C activity Zinc ionsInhibits enzymatic function
Platelet-activating factor (PAF)Degrades PAF via PLC activity Bile salts (TC, TCDC)Activates at critical micelles

Enzymatic Assay Protocol

A standardized activity assay uses malachite green detection for phosphate release:

ParameterDetails
SubstrateSphingomyelin (0.4 mM in assay buffer)
Enzyme0.2 µg/mL rhENPP7
Incubation20 min at room temperature
DetectionMalachite green reagent (A+B mix) at 620 nm absorbance
Specific ActivityCalculated as pmol/min/µg using phosphocholine standard curves

Cancer Research

ENPP7 deficiency is associated with:

  • Colorectal Carcinomas: Mutant forms lacking exon 4 show complete inactivation .

  • Therapeutic Potential: Recombinant ENPP7 supplementation may restore ceramide levels, inhibiting tumor growth .

Inflammatory Diseases

  • Ulcerative Colitis: Rectal administration of rhENPP7 improves inflammation in animal models .

  • PAF Regulation: ENPP7’s PAF-degrading activity suggests a role in managing inflammatory disorders .

Cholesterol Metabolism

ENPP7 enhances sphingomyelin-induced inhibition of cholesterol absorption by generating ceramide, which disrupts lipid micelles .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a guideline for customer use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ENPP7; UNQ3077/PRO9912; Ectonucleotide pyrophosphatase/phosphodiesterase family member 7; E-NPP 7; NPP-7; Alkaline sphingomyelin phosphodiesterase; Intestinal alkaline sphingomyelinase; Alk-SMase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-458
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
ENPP7
Target Protein Sequence
APVQSQGSQNKLLLVSFDGFRWNYDQDVDTPNLDAMARDGVKARYMTPAFVTMTSPCHFT LVTGKYIENHGVVHNMYYNTTSKVKLPYHATLGIQRWWDNGSVPIWITAQRQGLRAGSFF YPGGNVTYQGVAVTRSRKEGIAHNYKNETEWRANIDTVMAWFTEEDLDLVTLYFGEPDST GHRYGPESPERREMVRQVDRTVGYLRESIARNHLTDRLNLIITSDHGMTTVDKRAGDLVE FHKFPNFTFRDIEFELLDYGPNGMLLPKEGRLEKVYDALKDAHPKLHVYKKEAFPEAFHY ANNPRVTPLLMYSDLGYVIHGRINVQFNNGEHGFDNKDMDMKTIFRAVGPSFRAGLEVEP FESVHVYELMCRLLGIVPEANDGHLATLLPMLHTESALPPDGRPTLLPKGRSALPPSSRP LLVMGLLGTVILLSEVA
Uniprot No.

Target Background

Function
Recombinant Human Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 (ENPP7) is a choline-specific phosphodiesterase that hydrolyzes sphingomyelin, releasing ceramide and phosphocholine. This enzyme plays a crucial role in sphingomyelin digestion, ceramide formation, and fatty acid absorption within the gastrointestinal tract. ENPP7 also exhibits phospholipase C activity, cleaving phosphocholine from palmitoyl lyso-phosphatidylcholine and platelet-activating factor (PAF), thereby inactivating PAF. It lacks nucleotide pyrophosphatase activity. ENPP7 may promote cholesterol absorption by influencing sphingomyelin levels derived from dietary or endogenous sources within the intestinal lumen.
Gene References Into Functions
  1. Human alkaline sphingomyelinase crystal structure provides insights into substrate recognition. PMID: 28292932
  2. NPP7 activity and the ratio of 1.4/1.2 kb products in bile are significantly decreased in malignancy, particularly in cholangiocarcinoma. PMID: 25100243
  3. The F275A mutation of NPP7 showed impaired catalytic function, while the L107F mutation showed enhanced catalytic activity. PMID: 22177013
  4. Homology modeling using a recently crystallized bacterial NPP predicted the three-dimensional structure of NPP7. Docking studies using this model investigated the enzyme's substrate specificity. PMID: 20839774
  5. The amino acid and cDNA sequences of human intestinal alk-SMase were identified, revealing a novel ecto-enzyme related to the ecto-nucleotide phosphodiesterase family with specific features essential for its SMase activity. PMID: 12885774
  6. Intestinal alkaline sphingomyelinase may have a one-exon deletion in colon cancer cells. PMID: 15016655
  7. Alkaline sphingomyelinase activity is significantly affected by defective N-glycosylation at five sites and by structural alterations of the putative metal-binding sites and the predicted active core. PMID: 15458386
  8. This study describes the cloning of rat alkaline sphingomyelinase from rat intestine, its comparison to the human sequence, adjustment of the putative protein in GenBank, and confirmation of its specific expression in the small intestine. PMID: 15708357
  9. Alkaline sphingomyelinase hydrolyzes and inactivates PAF through phospholipase C activity, a novel function that may counteract intestinal inflammation and colon cancer development. PMID: 16255717
Database Links

HGNC: 23764

OMIM: 616997

KEGG: hsa:339221

STRING: 9606.ENSP00000332656

UniGene: Hs.114084

Protein Families
Nucleotide pyrophosphatase/phosphodiesterase family
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Detected in the colon (at protein level). Expressed in the duodenum, jejunum and liver and at low levels in the ileum. Expression was very low in the esophagus, stomach and colon.

Q&A

What is ENPP7 and how does it differ from other ENPP family members?

ENPP7 (ectonucleotide pyrophosphatase/phosphodiesterase 7) is an enzyme encoded by the ENPP7 gene in humans. It's also known as alkaline sphingomyelinase (Alk-SMase) or intestinal alkaline sphingomyelinase. Unlike other ENPP family members (ENPP1-6), ENPP7 has evolved specifically to hydrolyze sphingomyelin rather than nucleotides. While ENPP1-3 are multidomain proteins with two N-terminal somatomedin B-like domains, a PDE domain, a "lasso" loop, and a C-terminal nuclease-like domain, ENPP7 possesses only the signature PDE domain . Importantly, ENPP7 shares no structural similarities with either acid or neutral sphingomyelinases but belongs to the ENPP family based on cloning studies .

What is the tissue distribution of ENPP7?

ENPP7 has a unique tissue distribution pattern compared to other ENPP members. It is primarily expressed in the intestinal mucosa across various species, with additional expression in human liver. Within the intestinal tract, ENPP7 activity demonstrates regional variation - it's low in the duodenum and colon but significantly higher in the middle of the jejunum. As an ectoenzyme, ENPP7 is located on the surface of the intestinal mucosa and is released into the lumen by bile salt and pancreatic trypsin. In humans, the enzyme expressed in the liver is released in bile and delivered to the intestine .

How do you detect ENPP7 in biological samples?

Detection of human ENPP7 in biological samples can be accomplished using:

  • Western Blot: Using specific antibodies such as Mouse Anti-Human ENPP-7/Alk-SMase Monoclonal Antibody. In human small intestine tissue lysates, ENPP7 appears as a specific band at approximately 60 kDa under reducing conditions .

  • Enzymatic Activity Assays: Measuring ENPP7 activity by its ability to hydrolyze sphingomyelin into ceramide and phosphocholine. The released phosphate can be detected using colorimetric assays such as the Malachite Green Phosphate Detection method .

  • Immunohistochemistry: Using specific antibodies to visualize the tissue distribution of ENPP7, particularly in intestinal mucosa samples.

What is the catalytic mechanism of ENPP7 and how does it differ from other phosphodiesterases?

ENPP7 employs an associative two-step in-line displacement mechanism for catalysis, similar to what was originally described for alkaline phosphatases. The catalytic site contains two zinc ions essential for catalysis, located in a shallow groove where the substrate binds. These Zn²⁺ ions are coordinated by seven highly conserved residues: two histidines and an aspartate bind to Zn1, while two aspartates, a histidine, and the catalytic nucleophile (threonine) hold Zn2 .

The catalytic mechanism proceeds as follows:

  • The catalytic nucleophile (threonine) is activated by the Zn2 ion

  • A nucleophilic attack cleaves the scissile phosphodiester bond, forming the first leaving group

  • A water-based attack on the enzyme-product intermediate completes the reaction, allowing departure of the second leaving group

While this general mechanism is shared with other ENPP members, ENPP7 differs in its substrate specificity. Unlike ENPP1, ENPP3, ENPP4, and ENPP5 which hydrolyze nucleotides, ENPP7 has evolved as a phospholipase through adaptations in its catalytic domain .

How do bile salts affect ENPP7 activity and what are the mechanistic implications?

ENPP7 activity uniquely depends on the presence of bile salts, particularly primary bile salts like taurocholate (TC) and taurochenoate. This is a distinctive feature compared to other phosphodiesterases. Mechanistically, bile salts serve multiple critical functions for ENPP7 activity:

  • Substrate Solubilization: Bile salts form micelles that solubilize sphingomyelin, making it accessible to ENPP7.

  • Enzyme Activation: Certain bile salts directly interact with specific domains on ENPP7, inducing conformational changes that enhance catalytic efficiency.

  • Surface Recognition: The cationic patch and unique hydrophobic loop identified on ENPP7's surface are essential for accessing sphingomyelin in bile salt micelles, as confirmed by mutational analysis and enzymatic activity assays .

This bile salt dependency aligns with ENPP7's physiological function in the intestinal tract, where bile salts are naturally present and facilitate dietary lipid digestion .

What is the recommended protocol for measuring ENPP7 enzyme activity in vitro?

A standardized protocol for measuring ENPP7 enzyme activity involves:

Materials required:

  • Recombinant Human ENPP-7/Alk-SMase (rhENPP-7)

  • Substrate: Sphingomyelin (egg, chicken) (SPM)

  • Phosphocholine Chloride (100 mM stock in deionized water)

  • Recombinant Human Alkaline Phosphatase/ALPL (rhALPL)

  • Malachite Green Phosphate Detection Kit

  • 96-well Clear Plate

  • Plate Reader (e.g., SpectraMax Plus or equivalent)

Procedure:

  • Dilute SPM to 0.4 mM in Assay Buffer (heat buffer to 100°C then add SPM for proper solubilization, vortex well)

  • Dilute rhENPP-7 to 0.2 µg/mL in Assay Buffer

  • Mix 50 µL of SPM and 50 µL of rhENPP-7 to start the reaction (use Assay Buffer instead of SPM for blank control)

  • Incubate at room temperature for 20 minutes

  • Prepare Malachite Green reagent by mixing equal volumes of Reagents A and B

  • Add 80 µL of the Malachite Green mixture to all samples and vortex

  • Incubate at room temperature for exactly 10 minutes (avoiding longer incubation to prevent precipitation)

  • Load 70 µL from each sample into a plate

  • Read plate at 620 nm (absorbance) in endpoint mode

Calculation:
Specific Activity (pmol/min/µg) = Phosphate released (pmol) / [Incubation time (min) × amount of enzyme (µg)]

Typical reaction conditions include 0.0025 µg rhENPP-7 and 0.071 mM Sphingomyelin per well .

What is the potential role of ENPP7 in cancer research and what methodologies are used to study it?

ENPP7 has demonstrated significant implications in cancer research, particularly colorectal cancer. Studies have shown decreased ENPP7 activity in human colorectal adenocarcinomas and carcinomas, suggesting its potential role as a tumor suppressor . Research methodologies to study ENPP7 in cancer contexts include:

  • Expression Analysis: Comparing ENPP7 mRNA and protein expression levels between normal and cancerous tissues using RT-PCR, Western blot, and immunohistochemistry.

  • Activity Assays: Measuring ENPP7 enzymatic activity in tissue samples to detect functional alterations even when expression levels might appear normal.

  • Functional Studies: Overexpressing or knocking down ENPP7 in cancer cell lines to observe effects on:

    • Cell proliferation and apoptosis

    • Ceramide production (a potential mediator of anti-cancer effects)

    • Sphingolipid metabolism alterations

  • Methylation Analysis: Examining ENPP7 gene promoter methylation status as a potential mechanism of gene silencing in cancer.

Research indicates that ENPP7's anti-cancer effects may be mediated through its production of ceramide, which can induce apoptosis and inhibit cell proliferation. Additionally, its ability to inactivate platelet-activating factor (PAF) through phospholipase C-type activity may contribute to its tumor-suppressive properties .

How does recombinant ENPP7 compare with native enzyme in experimental applications?

ParameterRecombinant Human ENPP7Native ENPP7
Molecular Weight~60 kDa~60 kDa
pH Optimum9.09.0
Substrate SpecificitySphingomyelin > PAFSphingomyelin > PAF
Bile Salt DependencyYesYes
GlycosylationLess complex patternsTissue-specific patterns
StabilityGenerally more stableVariable based on source
Activity ConsistencyBatch-to-batch consistencyVariable between preparations
SourceExpression systems (typically mammalian)Intestinal tissue extraction
ApplicationsIn vitro enzymatic studies, structural analysisPhysiological studies

When using recombinant ENPP7 for research, consider these methodological adaptations:

  • Include appropriate bile salts in reaction buffers to ensure optimal activity

  • Pre-warm and properly solubilize sphingomyelin substrates

  • Consider the impact of different expression systems on post-translational modifications

  • Validate activity using standardized assays with appropriate controls

What are the best experimental models for studying ENPP7 function in vivo?

Several experimental models have proven valuable for investigating ENPP7 function in vivo:

  • Knockout Mouse Models: ENPP7-/- mice provide insights into the physiological roles of ENPP7 in sphingomyelin digestion and intestinal lipid absorption. These models allow researchers to study:

    • Alterations in sphingomyelin metabolism

    • Changes in ceramide levels in intestinal tissues

    • Effects on dietary fat absorption and processing

    • Susceptibility to intestinal inflammation or cancer development

  • Intestinal Organoids: These 3D cultures of intestinal epithelial cells better recapitulate the in vivo environment compared to traditional cell lines. For ENPP7 studies, organoids can be derived from:

    • Different intestinal segments (jejunum, duodenum, colon)

    • Normal or diseased human tissues

    • Genetically modified mouse models

  • Conditional Expression Systems: Using Cre-loxP or tetracycline-inducible systems to control ENPP7 expression in specific tissues and at specific timepoints.

  • Humanized Mouse Models: Particularly useful for studying the human-specific aspects of ENPP7 function, especially its expression in the liver and secretion in bile, which differs from some other species.

When selecting an appropriate model, consider regional expression patterns of ENPP7 (highest in jejunum) and the importance of including physiologically relevant bile salt compositions in experimental designs .

What are the key considerations when designing experiments with recombinant ENPP7?

When designing experiments with recombinant ENPP7, researchers should consider these critical factors:

  • Buffer Composition:

    • Include appropriate bile salts (taurocholate or taurochenoate) for optimal activity

    • Maintain alkaline pH (optimal at pH 9.0)

    • Consider ionic strength effects on enzyme-substrate interactions

  • Substrate Preparation:

    • Heat buffer to 100°C before adding sphingomyelin for proper solubilization

    • Ensure thorough vortexing of lipid substrates

    • Consider substrate concentration effects (typical working concentration: 0.071-0.4 mM sphingomyelin)

  • Enzyme Storage and Handling:

    • Store at -20 to -70°C for long-term storage

    • Limit freeze-thaw cycles to maintain activity

    • Store at 2-8°C for up to 1 month after reconstitution under sterile conditions

  • Controls and Validation:

    • Include enzyme-free negative controls

    • Use phosphocholine standards for quantification

    • Consider including known inhibitors as additional controls

    • Verify activity batch-to-batch using standardized assays

  • Detection Methods:

    • Select appropriate detection method based on experimental goals (direct product detection vs. coupled enzyme assays)

    • Consider sensitivity requirements (Malachite Green provides high sensitivity for phosphate detection)

    • Account for potential interfering compounds in complex biological samples

How can ENPP7 activity be distinguished from other sphingomyelinases in biological samples?

Distinguishing ENPP7 activity from other sphingomyelinases (acid and neutral SMases) in biological samples requires leveraging their distinctive biochemical properties:

  • pH Dependency:

    • ENPP7/Alk-SMase: Optimal activity at pH 9.0

    • Acid SMase: Optimal activity at pH 4.5-5.0

    • Neutral SMase: Optimal activity at pH 7.0-7.5

    Methodology: Perform parallel assays at different pH values to separate activities.

  • Bile Salt Dependency:

    • ENPP7/Alk-SMase: Requires bile salts for activity

    • Acid and Neutral SMases: Generally do not require bile salts

    Methodology: Compare activity in the presence and absence of bile salts.

  • Cation Requirements:

    • ENPP7/Alk-SMase: Zinc-dependent

    • Neutral SMase: Magnesium-dependent

    • Acid SMase: No specific metal ion requirement

    Methodology: Use specific chelators or add different metal ions.

  • Specific Inhibitors:

    • Selective inhibition with specific compounds targeting each enzyme class

    Methodology: Use GW4869 for neutral SMase, tricyclic antidepressants for acid SMase.

  • Immunodepletion:

    • Use specific antibodies to deplete ENPP7 from samples

    Methodology: Compare activity before and after immunodepletion with anti-ENPP7 antibodies.

  • Expression Pattern Analysis:

    • ENPP7 has a distinctive tissue distribution (intestine, liver)

    Methodology: Consider the source tissue when interpreting results .

By combining these approaches, researchers can accurately attribute sphingomyelinase activity to ENPP7 versus other SMases in complex biological samples.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.