Recombinant Human EF-hand domain-containing family member A2 (EFHA2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MICU3; EFHA2; Calcium uptake protein 3, mitochondrial; EF-hand domain-containing family member A2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-530
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MICU3
Target Protein Sequence
MAALRRLLWPPPRVSPPLCAHQPLLGPWGRPAVTTLGLPGRPFSSREDEERAVAEAAWRR RRRWGELSVAAAAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIP VAAAKETVAIGRTDIEDLDLYATSRERRFRLFASIECEGQLFMTPYDFILAVTTDEPKVA KTWKSLSKQELNQMLAETPPVWKGSSKLFRNLKEKGVISYTEYLFLLCILTKPHAGFRIA FNMFDTDGNEMVDKKEFLVLQEIFRKKNEKREIKGDEEKRAMLRLQLYGYHSPTNSVLKT DAEELVSRSYWDTLRRNTSQALFSDLAERADDITSLVTDTTLLVHFFGKKGKAELNFEDF YRFMDNLQTEVLEIEFLSYSNGMNTISEEDFAHILLRYTNVENTSVFLENVRYSIPEEKG ITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQDEFKRAVYVATGLKFSPHLVNTVFK IFDVDKDDQLSYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKKELHSR
Uniprot No.

Target Background

Function
Plays a potential role in mitochondrial calcium uptake.
Database Links

HGNC: 27820

OMIM: 610633

KEGG: hsa:286097

STRING: 9606.ENSP00000321455

UniGene: Hs.403594

Protein Families
MICU1 family, MICU3 subfamily
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What defines an EF-hand domain and how is it structured?

The EF-hand domain represents a helix-loop-helix calcium-binding motif found in numerous calcium-sensing and calcium-signal modulating proteins. This structural motif typically consists of approximately 30 amino acids with the calcium-binding site located within the loop region. The penta-EF-hand (PEF) protein family contains five such domains and includes proteins like ALG-2 (gene name PDCD6) and classical calpain family members . The canonical EF-hand structure allows for the coordination of calcium ions through specific amino acid residues positioned at defined locations within the loop, usually at positions 1, 3, 5, 7, 9, and 12, forming a pentagonal bipyramidal coordination geometry around the calcium ion.

What are the primary physiological roles of EF-hand domain proteins?

EF-hand domain proteins serve as critical calcium sensors and signal transducers in eukaryotic cells. According to current research, proteins such as ALG-2 interact with a variety of proteins in a Ca²⁺-dependent manner and participate in multiple cellular processes including cell death, signal transduction, membrane repair, ER-to-Golgi vesicular transport, and RNA processing . Some ALG-2-interacting proteins function as key components in the endosomal sorting complex required for transport (ESCRT) system. The calcium-binding capacity of these proteins enables them to undergo conformational changes upon calcium binding, facilitating interactions with target proteins and subsequently modulating downstream biological processes.

How are recombinant EF-hand proteins typically expressed and purified?

Recombinant EF-hand proteins are commonly expressed in bacterial systems such as E. coli, with modifications to enhance solubility and proper folding. Expression typically involves cloning the protein-coding sequence into a suitable expression vector containing an affinity tag (commonly a 6-His tag as seen with other recombinant proteins) . For purification, immobilized metal affinity chromatography (IMAC) is frequently employed as the initial capture step, followed by size exclusion chromatography to achieve higher purity. When working with EF-hand proteins, researchers must consider calcium chelation during purification steps to control the protein's conformational state. The final product may be formulated with or without carrier proteins such as Bovine Serum Albumin (BSA), with carrier-free versions being preferred for certain applications like structural studies or when avoiding potential interference is crucial .

What are the optimal expression systems for producing functional recombinant EF-hand proteins?

The selection of an expression system for recombinant EF-hand proteins depends on the research objectives and downstream applications. While prokaryotic systems like E. coli offer high yield and economic advantages, eukaryotic expression systems such as insect cells (Sf9, Sf21) or mammalian cells (HEK293, CHO) may be preferable when post-translational modifications are essential for protein function. For proper folding and calcium-binding capability, the expression conditions must be optimized with careful consideration of induction parameters, growth temperature, and media composition.

Many researchers employ a dual approach:

  • Initial screening in bacterial systems with various fusion tags (His, GST, MBP) to enhance solubility

  • Refined expression in eukaryotic systems for proteins requiring complex folding or modifications

For calcium-binding proteins like those in the PEF family, supplementation with calcium during expression can stabilize the protein structure and improve yield of correctly folded product.

What analytical methods are most effective for characterizing calcium binding to EF-hand domains?

Several complementary techniques provide comprehensive characterization of calcium binding to EF-hand domains:

  • Isothermal Titration Calorimetry (ITC): Provides direct measurement of binding thermodynamics, including binding constants (Kd), stoichiometry, enthalpy, and entropy changes

  • Circular Dichroism (CD) Spectroscopy: Monitors conformational changes upon calcium binding through alterations in secondary structure

  • Intrinsic Fluorescence Spectroscopy: Measures changes in tryptophan/tyrosine fluorescence intensity or emission maximum shifts upon calcium binding

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: Provides atomic-level details of calcium-induced structural changes and can identify specific residues involved in binding

  • Differential Scanning Calorimetry (DSC): Evaluates thermal stability enhancements conferred by calcium binding

The integration of these methods allows researchers to develop comprehensive models of calcium-dependent conformational dynamics that underlie the biological functions of EF-hand proteins like those in the PEF family .

How should researchers design experiments to study protein-protein interactions involving EF-hand proteins?

When investigating protein-protein interactions involving EF-hand proteins, researchers should employ calcium-controlled experimental designs with multiple complementary approaches:

  • Co-immunoprecipitation assays: Include both calcium-supplemented and calcium-chelated (EGTA) conditions to distinguish calcium-dependent interactions

  • Surface Plasmon Resonance (SPR): Quantify binding kinetics and affinity constants under varying calcium concentrations

  • Yeast Two-Hybrid or Mammalian Two-Hybrid systems: Modify to incorporate calcium-dependent interaction mechanisms

  • Proximity Labeling techniques: Apply BioID or APEX2 systems to capture transient calcium-dependent interactions

  • Cross-linking Mass Spectrometry (XL-MS): Map interaction interfaces with calcium-bound versus calcium-free states

For PEF proteins like ALG-2, which demonstrate interactions with various proteins in calcium-dependent manner, researchers should pay particular attention to the ESCRT system components, as several ALG-2-interacting proteins function in this pathway . Additionally, mutation of key calcium-coordinating residues in the EF-hand domains can provide valuable negative controls to confirm calcium dependency of observed interactions.

What are the current challenges in structural studies of EF-hand domain-containing proteins?

Structural studies of EF-hand domain-containing proteins face several significant challenges:

  • Conformational Heterogeneity: EF-hand proteins often exist in multiple conformational states depending on calcium occupancy, creating challenges for crystallization and structural determination

  • Domain Flexibility: The presence of flexible linkers between domains can hinder crystallization efforts

  • Expression and Purification Issues: Achieving sufficient quantities of properly folded protein with homogeneous calcium binding states remains difficult

  • Complex Formation: Many EF-hand proteins function through interactions with multiple partners, requiring co-expression or co-crystallization strategies

  • Calcium Concentration Control: Maintaining precise calcium concentrations throughout purification and crystallization is technically challenging

Researchers studying PEF proteins have employed strategies including truncation constructs, calcium titration during purification, and co-crystallization with binding partners to overcome these challenges . Advanced structural biology techniques like cryo-electron microscopy (cryo-EM) are increasingly being applied to capture dynamic conformational states of these proteins.

How can researchers distinguish between specific and non-specific calcium-binding effects in functional studies?

Distinguishing specific from non-specific calcium-binding effects requires rigorous experimental design:

For PEF proteins such as ALG-2, researchers should carefully evaluate calcium dependency of protein-protein interactions, as these interactions form the basis for their biological functions in processes like vesicular transport and cell death regulation .

What emerging technologies are advancing research on EF-hand protein dynamics?

Several cutting-edge technologies are revolutionizing our understanding of EF-hand protein dynamics:

  • Time-Resolved X-ray Crystallography: Captures transient conformational states during calcium binding and release

  • Single-Molecule FRET (smFRET): Monitors real-time conformational changes in individual protein molecules upon calcium binding

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Maps structural dynamics and solvent accessibility changes

  • Advanced Molecular Dynamics Simulations: Predicts calcium-dependent conformational changes with improved force fields for divalent cations

  • AlphaFold2 and Related AI Tools: Predicts structures of protein complexes involving EF-hand proteins with increasing accuracy

  • Optogenetic Calcium Sensors: Enables precise spatiotemporal control of calcium levels in live cells

These technologies are particularly valuable for studying PEF proteins like ALG-2, which undergo significant conformational changes upon calcium binding to mediate interactions with binding partners in various cellular pathways .

What is known about the role of EF-hand domain proteins in disease pathogenesis?

EF-hand domain proteins are implicated in various pathological processes through dysregulation of calcium signaling:

  • Neurodegenerative Disorders: Several EF-hand proteins play roles in calcium homeostasis disturbances associated with Alzheimer's and Parkinson's diseases

  • Cancer Progression: Altered expression of certain EF-hand proteins contributes to apoptosis resistance and enhanced cell migration

  • Cardiovascular Diseases: Dysregulation of calcium-binding proteins affects cardiac contractility and vascular tone

  • Inflammatory Conditions: Some EF-hand proteins modulate inflammatory signaling cascades

Research on PEF proteins like ALG-2 has revealed their involvement in critical cellular processes including programmed cell death, membrane repair, and vesicular transport systems . Dysregulation of these processes contributes to disease development, making these proteins potential therapeutic targets.

How can recombinant EF-hand proteins be utilized in drug discovery research?

Recombinant EF-hand proteins serve multiple functions in drug discovery pipelines:

  • Target-Based Screening Platforms: Purified proteins enable high-throughput screening for small molecule modulators

  • Structure-Based Drug Design: High-resolution structural data facilitates rational design of compounds that modulate calcium binding or protein-protein interactions

  • Biophysical Interaction Studies: Surface plasmon resonance and related techniques using recombinant proteins quantify binding parameters of lead compounds

  • Cellular Assay Development: Recombinant proteins can be used to develop competition assays for evaluating compound cellular penetration and target engagement

  • Protein-Protein Interaction Disruption Assays: Identifies compounds that specifically block calcium-dependent interactions

When working with recombinant EF-hand proteins in drug discovery, researchers must ensure that the protein maintains its native conformation and calcium-binding properties. For this purpose, carrier-free protein preparations, similar to those described for other recombinant proteins, may be preferred to avoid interference from carrier proteins like BSA .

What are the key considerations for designing calcium-dependency experiments with recombinant EF-hand proteins?

When designing experiments to investigate calcium dependency of EF-hand proteins, researchers should consider:

  • Calcium Buffering Systems: Utilize calcium buffers (EGTA/Ca²⁺ or BAPTA/Ca²⁺ mixtures) to achieve precisely controlled free calcium concentrations

  • Physiological Relevance: Design experiments that reflect the physiological calcium concentration range (100 nM - 1 μM for resting cells, up to 10 μM during signaling events)

  • Buffer Composition Effects: Account for pH, ionic strength, and presence of other divalent cations (particularly Mg²⁺) that affect calcium binding

  • Protein Stability Considerations: Ensure that calcium-free states of the protein remain stable and properly folded throughout experimental procedures

  • Time-Resolved Measurements: Include kinetic analyses to capture transient states during calcium binding and release

For PEF proteins like ALG-2, which exhibit calcium-dependent interactions with multiple binding partners, researchers should establish complete calcium-response curves rather than testing only calcium-free and calcium-saturated conditions .

How should researchers approach quality control for recombinant EF-hand proteins?

Rigorous quality control for recombinant EF-hand proteins should include:

  • Purity Assessment:

    • SDS-PAGE with Coomassie staining (>95% purity)

    • Mass spectrometry to confirm molecular weight and detect modifications

  • Structural Integrity Verification:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Thermal shift assays to assess stability

    • Limited proteolysis to evaluate conformational homogeneity

  • Functional Characterization:

    • Calcium-binding capacity using ITC or fluorescence-based assays

    • Interaction with known binding partners via pull-down assays or SPR

  • Storage Stability Testing:

    • Evaluate different buffer compositions and storage conditions

    • Perform accelerated stability studies and freeze-thaw cycle testing

  • Lot-to-Lot Consistency:

    • Establish quantitative acceptance criteria for batch release

    • Maintain reference standards for comparative analysis

When working with carrier-free protein preparations, researchers should be particularly attentive to protein stability and potential aggregation issues, as the absence of stabilizing carrier proteins like BSA can affect protein behavior during storage and experimentation .

What are the emerging areas of research involving EF-hand domain proteins?

Exciting new frontiers in EF-hand protein research include:

  • Systems Biology Approaches: Integration of proteomics, transcriptomics, and metabolomics to map complete calcium signaling networks involving EF-hand proteins

  • Development of Specific Modulators: Design of compounds that selectively target individual EF-hand proteins for research and therapeutic applications

  • Calcium Signaling Microdomains: Investigation of spatially restricted calcium signaling events and the role of localized EF-hand proteins

  • Interactome Mapping: Comprehensive identification of calcium-dependent and calcium-independent binding partners

  • Synthetic Biology Applications: Engineering EF-hand domains with novel properties for biosensing and cellular control systems

For PEF proteins like ALG-2, further exploration of their roles in the ESCRT system and connections to calpain family members represents a particularly promising direction . The convergence of these proteins in common cellular pathways suggests potential synergistic functions that remain to be fully characterized.

How might advances in structural biology techniques impact EF-hand protein research?

Recent and anticipated advances in structural biology will transform EF-hand protein research:

  • Cryo-Electron Microscopy Improvements: Enhanced resolution and capabilities for analyzing smaller proteins will reveal dynamic conformational changes during calcium binding

  • Integrative Structural Biology: Combining multiple techniques (X-ray crystallography, NMR, cryo-EM, SAXS) will provide more complete structural models

  • Time-Resolved Structural Methods: Capturing transient intermediates during calcium binding and protein-protein interactions

  • In-Cell Structural Biology: Determining structures within native cellular environments rather than with purified components

  • AI-Enhanced Structure Prediction: Improved computational prediction of calcium-bound and calcium-free states along with protein-protein complexes

These advances will be particularly valuable for understanding the structural basis of calcium-dependent interactions between PEF proteins like ALG-2 and their binding partners in the context of complex cellular processes such as vesicular transport and programmed cell death .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.