Recombinant Human EGF-like module-containing mucin-like hormone receptor-like 2 (EMR2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have any specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your specific needs.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize the development of that tag.
Synonyms
ADGRE2; EMR2; Adhesion G protein-coupled receptor E2; EGF-like module receptor 2; EGF-like module-containing mucin-like hormone receptor-like 2; CD antigen CD312
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-823
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
QDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFS DCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSY TCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPN GPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMT FSTWTPPPGVHSQTLSRFFDKVQDLGRDYKPGLANNTIQSILQALDELLEAPGDLETLPR LQQHCVASHLLDGLEDVLRGLSKNLSNGLLNFSYPAGTELSLEVQKQVDRSVTLRQNQAV MQLDWNQAQKSGDPGPSVVGLVSIPGMGKLLAEAPLVLEPEKQMLLHETHQGLLQDGSPI LLSDVISAFLSNNDTQNLSSPVTFTFSHRSVIPRQKVLCVFWEHGQNGCGHWATTGCSTI GTRDTSTICRCTHLSSFAVLMAHYDVQEEDPVLTVITYMGLSVSLLCLLLAALTFLLCKA IQNTSTSLHLQLSLCLFLAHLLFLVAIDQTGHKVLCSIIAGTLHYLYLATLTWMLLEALY LFLTARNLTVVNYSSINRFMKKLMFPVGYGVPAVTVAISAASRPHLYGTPSRCWLQPEKG FIWGFLGPVCAIFSVNLVLFLVTLWILKNRLSSLNSEVSTLRNTRMLAFKATAQLFILGC TWCLGILQVGPAARVMAYLFTIINSLQGVFIFLVYCLLSQQVREQYGKWSKGIRKLKTES EMHTLSSSAKADTSKPSTVN
Uniprot No.

Target Background

Function
EMR2 (EGF-like module-containing mucin-like hormone receptor-like 2) is a cell surface receptor that binds to the chondroitin sulfate moiety of glycosaminoglycan chains, promoting cell attachment. It plays a role in promoting granulocyte chemotaxis, degranulation, and adhesion. In macrophages, EMR2 promotes the release of inflammatory cytokines, including IL8 and TNF. Signaling likely occurs through G-proteins. EMR2 is a regulator of mast cell degranulation.
Gene References Into Functions
  1. miR-99a identifies two novel targets, E2F2 and EMR2, that play a crucial role in lung tumorigenesis. By inhibiting E2F2 and EMR2, miR-99a represses the epithelial-to-mesenchymal transition (EMT) process in vivo, concurrently inhibiting stemness features and reducing the cancer stem cell population. PMID: 29072692
  2. EMR2 expression levels correlate with Child-Pugh-Turcotte (CTP) scores and further increase in cirrhotic patients with infections. These neutrophils with high EMR2 expression exhibit an activated phenotype but with impaired functions. Higher levels of these EMR2-expressing neutrophils correlate with infectious complications and predict mortality. PMID: 27905560
  3. Data suggest that blood neutrophils expressing CD11c antigen and EMR2 protein may be considered as potential biomarkers for sepsis and systemic inflammatory response syndrome (SIRS), respectively. PMID: 26153037
  4. A previously unknown missense substitution in ADGRE2, predicted to result in the replacement of cysteine with tyrosine as the only nonsynonymous variant cosegregating with vibratory urticaria, was identified in two large kindreds. PMID: 26841242
  5. Using the myeloid cell-restricted EMR2 receptor as a model, we examine the mechanistic relevance of the subunit interaction and demonstrate a critical role for autoproteolysis in mediating receptor signaling and cell activation. PMID: 22310662
  6. A functional role for EMR2 in modulating neutrophil activation during inflammation is established. PMID: 22035891
  7. High EMR2 expression is associated with an invasive phenotype in glioblastoma. PMID: 21503828
  8. The association of improved patient survival with higher nuclear expression levels identifies EMR2 as a potential biomarker in patients with invasive breast cancer. PMID: 21174063
  9. Complex cellular expression programs, rather than activation modes, regulate the expression of EGF-TM7 receptors in macrophages. PMID: 20167235
  10. Epidermal growth factor-like domains of the human EMR2 receptor mediate cell attachment through chondroitin sulfate glycosaminoglycans. PMID: 12829604
  11. The role of the extracellular stalk and the G protein-coupled receptor proteolysis site motif in EMR2 processing is explored. PMID: 12860403
  12. Site-directed mutagenesis of the P(+1) cleavage site (Ser(518)) reveals an absolute requirement of a Ser, Thr, or Cys residue for efficient proteolysis. PMID: 15150276
  13. These findings further support the idea that EMR2 plays a role in the migration and adhesion of myeloid cells during cell differentiation, maturation, and activation. PMID: 17174274
  14. Here we demonstrate how the human-restricted adhesion-GPCR EMR2 regulates neutrophil responses by potentiating the effects of various proinflammatory mediators and show that the transmembrane region is crucial for adhesion-GPCR function. PMID: 17928360
  15. EGF-TM7 pre-mRNAs also undergo the rare trans-splicing, leading to the generation of functional chimeric receptors. PMID: 18267122

Show More

Hide All

Database Links

HGNC: 3337

OMIM: 125630

KEGG: hsa:30817

STRING: 9606.ENSP00000472280

UniGene: Hs.531619

Involvement In Disease
Vibratory urticaria (VBU)
Protein Families
G-protein coupled receptor 2 family, Adhesion G-protein coupled receptor (ADGR) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, ruffle membrane; Multi-pass membrane protein.
Tissue Specificity
Expression is restricted to myeloid cells. Highest expression was found in peripheral blood leukocytes, followed by spleen and lymph nodes, with intermediate to low levels in thymus, bone marrow, fetal liver, placenta, and lung, and no expression in heart

Q&A

What is EMR2 and what is its basic molecular classification?

EMR2 (also known as ADGRE2) is a human myeloid-restricted adhesion G protein-coupled receptor (aGPCR) that belongs to group II GPCRs and is functionally included in the family of brain angiogenesis inhibitor molecules (BAIs) . EMR2 is highly homologous to F4/80, a widely acknowledged surface marker that defines murine tissue macrophages . As a typical aGPCR, EMR2 undergoes autoproteolytic processing at the extracellular GPCR proteolysis site (GPS) and is expressed as a bipartite complex containing the extracellular N-terminal fragment (NTF) and the seven-transmembrane (7TM) C-terminal fragment (CTF) .

What is the domain structure of EMR2 and how can it be modeled?

EMR2 contains multiple epidermal growth factor (EGF)-like modules in its extracellular domain (ECD) . Structural analysis using GPCRDB, DOMAC, and SCRATCH programs reveals that EMR2 is composed of five distinct domains :

  • First domain: Modeled using templates including EGF domain with barium (PDB ID: 2BO2)

  • Second domain: Similar to the first domain

  • Third domain: Modeled with human notch-1 ligand binding protein (PDB ID: 1TOZ_A)

  • Fourth domain: Shows good DOPE score (35.88)

  • Fifth domain: Composed of EGF-TM7 helices

Ramachandran plot analysis of EMR2 domains showed that 72%-90% of residues fell within the most favored regions, 3%-31% in additionally allowed regions, and 2%-14% in generously allowed regions .

Where is EMR2 primarily expressed in human tissues?

EMR2 expression is myeloid-restricted, with expression primarily in:

  • Monocytes/macrophages

  • Neutrophils

  • Myeloid dendritic cells (DCs)

The strongest in vivo EMR2 protein expression is detected in CD16+ blood monocytes and BDCA-3+ myeloid DCs . Additionally, foamy macrophages in atherosclerotic vessels and splenic Gaucher cells exhibit high EMR2 positivity, whereas multiple sclerosis brain foam cells express little if any EMR2 .

How is EMR2 expression regulated during macrophage differentiation?

EMR2 serves as a novel surface marker of human macrophage differentiation. Research shows that:

  • EMR2 expression is persistently upregulated during in vitro differentiation of PMA-treated THP-1 cells into macrophage-like cells

  • The upregulated EMR2 expression levels correlate closely with macrophage phenotypic markers (CD4, CD9, CD11b, and CD81)

  • EMR2 protein expression increases during in vitro differentiation of macrophages but decreases following dendritic cell maturation

This dynamic expression pattern suggests a regulatory role of EMR2 in myeloid cell function and differentiation.

What methodologies can be used to assess EMR2 expression in patient samples?

Several methodological approaches can be employed to assess EMR2 expression:

  • Flow cytometry analysis: Using antibodies like the EMR2-specific 2A1 monoclonal antibody to detect surface expression on different cell populations

  • Western blotting: To assess protein expression levels in cell lysates

  • Quantitative PCR: For evaluation of EMR2 transcript levels

  • Immunohistochemistry: For tissue-specific expression patterns

For clinical samples, flow cytometry has been particularly useful in identifying EMR2 as a neutrophil biomarker in conditions like systemic inflammatory response syndrome (SIRS) and liver cirrhosis .

What are the primary signaling pathways activated by EMR2 in myeloid cells?

EMR2 activation triggers multiple signaling cascades:

What experimental approaches can be used to study EMR2-mediated signaling in vitro?

Researchers can employ several experimental approaches to study EMR2 signaling:

  • Receptor activation studies:

    • Use of receptor-specific monoclonal antibodies (e.g., 2A1 mAb) to bind and ligate EMR2

    • Immobilized vs. soluble antibody comparison to evaluate functional differences

  • Signaling inhibitor analysis:

    • PI3K inhibitors (Wortmannin, LY294002)

    • MAPK/ERK kinase inhibitors (PD98059, U0126)

    • JNK inhibitor (SP600125)

    • p38 inhibitor (SB203580)

    • PLC inhibitors (U73122)

  • Phosphorylation analysis:

    • Western blotting to detect phosphorylation of signaling molecules (ERK, JNK, Akt)

    • Time-course and dose-dependent studies

  • siRNA knockdown experiments:

    • Silencing EMR2 or downstream signaling molecules (e.g., Gα16) to confirm specificity

  • Functional readouts:

    • Cytokine/chemokine production (IL-8, TNF-α)

    • Matrix metalloproteinase expression (MMP-9)

    • Cell morphology and differentiation markers

How is EMR2 implicated in inflammatory conditions?

EMR2 plays significant roles in several inflammatory conditions:

What is the role of EMR2 in brain tumors, particularly gliomas?

EMR2 has several important implications in glioma biology:

  • Expression in glioma tissues: EMR2 is expressed in various histologic grades of gliomas .

  • Association with PI3K pathway: Both EMR2 and PI3K are upregulated in glioblastoma after bevacizumab therapy. The PI3K-Akt pathway is involved in tumorigenesis, and upregulation of EMR2 may in turn upregulate PI3K, leading to increased tumor invasiveness .

  • Correlation with tumor characteristics: Overexpression of EMR2 is associated with:

    • Mesenchymal glioblastoma subtype

    • Tumor invasiveness

    • Poor patient survival rates

    • Higher tumor grade

  • Role in tumor biology: EMR2 regulates neutrophil function by producing reactive oxygen species (ROS) and degranulation, which may contribute to the tumor microenvironment .

  • Potential therapeutic target: Research has explored approaches such as:

    • Stimulation of microglia and monocytes to inhibit tumor-initiating cells by down-regulating the EMR2 gene

    • Development of antibodies against EMR2

How can researchers effectively study EMR2 activation and its downstream effects?

Researchers can employ several advanced methodologies to study EMR2 activation:

  • Cell models:

    • THP-1 human monocytic cell line for differentiation studies

    • Primary human monocytes/macrophages for validation

    • Neutrophil isolation and activation assays

  • Activation methods:

    • Immobilized vs. soluble antibody comparison (e.g., 2A1 mAb)

    • Natural ligand (dermatan sulfate) stimulation

    • Mechanical stimulation in combination with ligands (especially for vibratory urticaria studies)

  • Readout systems:

    • Quantitative analysis of pro-inflammatory mediators (ELISA, qPCR)

    • Western blotting for signaling molecule phosphorylation

    • Flow cytometry for surface marker expression

    • Functional assays (chemotaxis, phagocytosis, ROS production)

    • Inflammasome activation (IL-1β processing, caspase-1 activation)

  • Statistical analysis:

    • Student's t-test for comparing differences between groups

    • Setting significance at p < 0.05, with asterisks indicating levels of significance (* p < 0.05, ** p < 0.01, *** p < 0.001)

What are potential approaches for targeting EMR2 for therapeutic purposes?

Several potential therapeutic approaches targeting EMR2 have been suggested:

  • Antibody-based therapies:

    • Development of antibodies against EMR2 that can modulate its function

    • Targeting specific domains of EMR2 to affect ligand binding or receptor activation

  • Small molecule inhibitors:

    • Designing competitive EMR2 inhibitors based on structure, function, and ligand binding sites

    • Targeting the Gα16 coupling or downstream signaling components like PLC or PI3K pathways

  • Gene modulation approaches:

    • siRNA or CRISPR-based downregulation of EMR2 in specific cell types

    • Modulation of EMR2 expression to affect myeloid cell differentiation and function

  • Targeting EMR2-ligand interactions:

    • Focusing on the residue Arg241, which is responsible for interaction with glycosaminoglycan and chondroitin sulfate

    • Developing molecules that mimic or block these interactions

What are the key considerations for accurately measuring EMR2 expression in clinical samples?

Researchers should consider several factors when measuring EMR2 expression:

  • Sample processing time: EMR2 expression may be affected by the time between sample collection and processing, potentially leading to activation of myeloid cells ex vivo.

  • Cell isolation methods: Different isolation protocols may affect the activation status of myeloid cells and consequently EMR2 expression.

  • Antibody selection: Using validated antibodies with appropriate controls is crucial for accurate measurement.

  • Measurement techniques: Flow cytometry is preferred for cellular expression studies, but immunohistochemistry may be necessary for tissue samples .

  • Data interpretation challenges:

    • Electronic medical records (EMRs) may contain measurement errors and misclassifications

    • Validation studies may be needed, using manual chart abstraction or alternative data sources

    • Loss to follow-up can introduce bias in longitudinal studies

How should researchers approach contradictory findings in EMR2 research?

When confronted with contradictory findings, researchers should:

  • Examine experimental conditions:

    • Differences in cell types used (THP-1 cells vs. primary cells)

    • Variations in activation methods (immobilized vs. soluble antibodies)

    • Differences in readout systems or time points

  • Consider context-dependent effects:

    • EMR2 activation alone may have different effects compared to activation in the presence of other stimuli

    • The priming effect of EMR2 on neutrophil activation should be taken into account

  • Analyze data quality issues:

    • Data discrepancies may arise from unstandardized data collection and documentation practices

    • Improperly matched data elements or variability in data vocabulary and definitions may contribute to contradictory findings

  • Validation approaches:

    • Cross-validate findings using multiple methodologies

    • Perform rigorous statistical analysis, including sensitivity analyses

    • Consider using validation studies with gold standard data when possible

What are the key unanswered questions about EMR2 function and biology?

Several important questions remain unanswered:

  • Structural determinants of EMR2 function:

    • How do specific domains contribute to receptor activation and signaling?

    • What is the molecular mechanism of EMR2 activation by mechanical forces?

  • Signaling network integration:

    • How does EMR2-mediated signaling interact with other pathways in different contexts?

    • What are the cell type-specific differences in EMR2 signaling?

  • Physiological roles:

    • What is the physiological function of EMR2 in tissue-resident macrophages?

    • How does EMR2 contribute to innate immune responses against pathogens?

  • Disease mechanisms:

    • How does EMR2 dysfunction contribute to inflammatory disorders beyond vibratory urticaria?

    • What is the role of EMR2 in cancer progression and metastasis?

What emerging technologies might advance EMR2 research?

Several emerging technologies hold promise for advancing EMR2 research:

  • Single-cell analysis:

    • Single-cell RNA sequencing to identify cell-specific expression patterns

    • Mass cytometry for high-dimensional analysis of EMR2+ cell populations

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize EMR2 localization and interactions

    • Live-cell imaging to study EMR2 dynamics during cellular activation

  • CRISPR-based approaches:

    • Gene editing to create specific EMR2 variants

    • CRISPR screens to identify EMR2 interaction partners and regulators

  • Computational modeling:

    • Molecular dynamics simulations of EMR2 structure and interactions

    • Systems biology approaches to integrate EMR2 into cellular signaling networks

  • Organoid and advanced 3D culture systems:

    • Study EMR2 function in more physiologically relevant contexts

    • Examine EMR2 in tissue-specific microenvironments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.